Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Marstacimab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Marstacimab ELISA Kit

Marstacimab ELISA Kit

Product name Marstacimab ELISA Kit
Uniprot ID P10646
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX172
Note For research use only.
Sample type Plasma, Serum
Target Marstacimab
Immunogen Marstacimab

Introduction to Marstacimab ELISA Kit

The Marstacimab ELISA Kit is a cutting-edge tool used in the field of biotechnology for the detection and quantification of Marstacimab, a novel therapeutic antibody. This kit is designed to provide accurate and reliable results in the measurement of Marstacimab levels in various biological samples. In this article, we will delve into the structure, activity, and application of this ELISA kit, highlighting its role as a valuable tool in the development of targeted therapies.

Structure of Marstacimab ELISA Kit

The Marstacimab ELISA Kit is composed of several key components that work together to accurately detect and quantify Marstacimab in biological samples. These include a microplate coated with a specific antibody against Marstacimab, a detection antibody labeled with an enzyme, and a substrate solution that produces a colorimetric signal in the presence of the enzyme. The kit also includes a standard curve and controls to ensure the accuracy and precision of the results.

The microplate is the most crucial component of the kit, as it serves as the solid support for the ELISA reaction. The plate is coated with a capture antibody that specifically binds to Marstacimab, allowing for the detection and quantification of the antibody in the sample. The detection antibody, labeled with an enzyme such as horseradish peroxidase, binds to the captured Marstacimab, forming a sandwich complex. The substrate solution is then added, and the enzyme catalyzes a reaction that produces a color change, which is directly proportional to the amount of Marstacimab present in the sample.

Activity of Marstacimab ELISA Kit

The Marstacimab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Marstacimab in various biological samples. The kit has a wide dynamic range, allowing for the measurement of Marstacimab levels in both high and low concentrations. This makes it a valuable tool for monitoring the efficacy of Marstacimab-based therapies and for conducting pharmacokinetic studies.

The activity of the kit is based on the principle of enzyme-linked immunosorbent assay (ELISA), a widely used technique in the field of biotechnology. The specificity of the capture and detection antibodies ensures that only Marstacimab is detected, eliminating any interference from other antibodies or proteins in the sample. The colorimetric signal produced by the enzyme allows for easy and accurate quantification of Marstacimab levels, making the kit a reliable and efficient tool for researchers and clinicians.

Application of Marstacimab ELISA Kit

The Marstacimab ELISA Kit has a wide range of applications in the field of biotechnology, particularly in the development and monitoring of Marstacimab-based therapies. As a therapeutic antibody, Marstacimab has shown promising results in the treatment of various diseases, including hemophilia A and sickle cell disease. The ELISA kit can be used to measure Marstacimab levels in patient samples, providing valuable information on the drug’s pharmacokinetics and efficacy.

Furthermore, the kit can also be used in preclinical studies to evaluate the pharmacokinetics and biodistribution of Marstacimab in animal models. This information is crucial in the development of new therapies and can aid in the optimization of dosing regimens for maximum efficacy.

In addition to its application in the development of Marstacimab-based therapies, the ELISA kit can also be used in basic research to study the role of Marstacimab in various disease pathways. By quantifying Marstacimab levels in different biological samples, researchers can gain a better understanding of the antibody’s mechanism of action and its potential as a therapeutic target.

Conclusion The Marstacim

Marstacimab ELISA Kit

There are no reviews yet.

Be the first to review “Marstacimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products