Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Concizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Concizumab ELISA Kit

Concizumab ELISA Kit

Product name Concizumab ELISA Kit
Uniprot ID P10646
Raw Antigen Sequence MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX171
Note For research use only.
Sample type Plasma, Serum
Target Concizumab
Immunogen Concizumab

The Structure and Function of Concizumab ELISA Kit

Concizumab is a monoclonal antibody that has recently emerged as a promising therapeutic target for the treatment of hemophilia A and B. It is a humanized IgG4 antibody that specifically binds to activated coagulation factor IX (FIXa), a key enzyme in the blood clotting cascade. The Concizumab ELISA Kit is a highly sensitive and specific assay designed to detect and quantify Concizumab levels in biological samples.

The Structure of Concizumab

Concizumab is a recombinant, fully humanized monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable regions of the antibody are responsible for its specificity, as they contain the antigen-binding site that recognizes and binds to FIXa.

The constant region of Concizumab is of the IgG4 subtype, which is known for its low affinity for Fc receptors and minimal effector function. This allows for a longer half-life and reduced immunogenicity of the antibody, making it an ideal candidate for long-term treatment.

The Mechanism of Action of Concizumab

The main function of Concizumab is to inhibit the activity of FIXa, thereby preventing the formation of blood clots. In hemophilia, there is a deficiency in clotting factor VIII (FVIII) or IX (FIX), leading to prolonged bleeding episodes. FIXa is a key enzyme in the coagulation cascade, responsible for activating FIX and ultimately leading to the formation of a stable blood clot.

Concizumab binds to the activated form of FIXa, blocking its interaction with FIX and preventing the formation of the blood clot. This results in a reduction in bleeding episodes and an overall improvement in the quality of life for patients with hemophilia A and B.

The Application of Concizumab ELISA Kit

The Concizumab ELISA Kit is a valuable tool for measuring the levels of Concizumab in biological samples. This information is crucial for monitoring the efficacy of treatment and determining the appropriate dosing regimen for each patient. The ELISA Kit utilizes a sandwich enzyme-linked immunosorbent assay, where Concizumab is captured by a specific antibody coated on a microplate and then detected by a secondary antibody conjugated to an enzyme.

The Concizumab ELISA Kit has been validated for use in human serum, plasma, and cell culture supernatants. It has a high sensitivity and specificity, with a lower limit of detection of 0.1 ng/mL. This allows for accurate and precise quantification of Concizumab levels, even at low concentrations.

Conclusion

In summary, Concizumab is a monoclonal antibody that specifically targets activated FIXa, a key enzyme in the coagulation cascade. The Concizumab ELISA Kit is a highly sensitive and specific assay that allows for the accurate measurement of Concizumab levels in biological samples. This information is crucial for monitoring the efficacy of treatment and optimizing dosing regimens for patients with hemophilia A and B.

Concizumab ELISA Kit

There are no reviews yet.

Be the first to review “Concizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products