Brand: ProteoGenix

InVivoMAb Anti-Human IL6 (Iv0022)

ARO-A13357-100
Validated ELISA FC WB

Clonality:: Monoclonal Antibody
Host species:: Human

Original price was: €490.00.Current price is: €366.00.

100ug 25% OFF + 366 loyalty points

Size Size

50ug Original price was: €356.00.Current price is: €256.00.
100ug Original price was: €490.00.Current price is: €366.00.
1MG Original price was: €1,347.00.Current price is: €1,061.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Datasheet

InVivoMAb Anti-Human IL6 (Iv0022)

Product name	ARO-A13357-100
Uniprot ID	P05231
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference	ARO-A13357
Clonality	Monoclonal Antibody
Protein Name	Hybridoma growth factor

Product name	ARO-A13357-1MG
Uniprot ID	P05231
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference	ARO-A13357
Clonality	Monoclonal Antibody
Protein Name	Hybridoma growth factor

Product name	ARO-A13357-50
Uniprot ID	P05231
Raw Antigen Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference	ARO-A13357
Clonality	Monoclonal Antibody
Protein Name	Hybridoma growth factor

Datasheet

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Target Cells were stained with an irrelevant antibody or InVivoMAb Anti-Human IL6 (Iv0022) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.