Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human IL6 (Iv0022)

  • ARO-A13357-50
  • Validated ELISA FC WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €356.00.Current price is: €256.00.

50ug 28% OFF + 256 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human IL6 (Iv0022)

Product name ARO-A13357-100
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A13357
Clonality Monoclonal Antibody
Protein Name Hybridoma growth factor
Product name ARO-A13357-1MG
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A13357
Clonality Monoclonal Antibody
Protein Name Hybridoma growth factor
Product name ARO-A13357-50
Uniprot ID P05231
Raw Antigen Sequence MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Hybridoma growth factor, BSF-2, IFN-beta-2, CDF, IL6, Interleukin-6, IL-6, B-cell stimulatory factor 2, Interferon beta-2, IFNB2, CTL differentiation factor
Reference ARO-A13357
Clonality Monoclonal Antibody
Protein Name Hybridoma growth factor

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Flow-cytometry using anti-human IL6 antibody.LPS treated THP-1 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human IL6 antibody monoclonal antibody (Catalog # ARO-A13357 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Flow Cytometry results for InVivoMAb Anti-Human IL6 (Iv0022)

Flow-cytometry using anti-human IL6 antibody.IL6 Transfected CHO cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human IL6 antibody monoclonal antibody (Catalog # ARO-A13357 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-human antibody (Catalog # PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for InVivoMAb Anti-Human IL6 (Iv0022)

SDS-PAGE for InVivoMAb Anti-Human IL6 (Iv0022)

InVivoMAb Anti-Human IL6 (Iv0022), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of InVivoMAb Anti-Human IL6 (Iv0022)

SEC-HPLC of InVivoMAb Anti-Human IL6 (Iv0022)

InVivoMAb Anti-Human IL6 (Iv0022) was analyzed by size exclusion chromatography with UV detection.

InVivoMAb Anti-Human IL6 (Iv0022) binds to IL6, C-His, recombinant protein in WB Assay

InVivoMAb Anti-Human IL6 (Iv0022) binds to IL6, C-His, recombinant protein in WB Assay

IL6, C-His, recombinant protein(cat. No.PX-P5793) can bind InVivoMAb Anti-Human IL6 (Iv0022) in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human IL6 (Iv0022)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products