Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

  • ARO-A16089-50
  • Validated FC WB

Original price was: €293.00.Current price is: €231.00.

50ug 21% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

Product name ARO-A16089-100
Uniprot ID P08887
Uniprot link P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms sIL6R, Interleukin-6 receptor subunit alpha, CD126, IL-6R 1, IL-6R subunit alpha, Membrane glycoprotein 80, gp80, IL6R, IL-6RA, IL-6 receptor subunit alpha, IL-6R-alpha
Reference ARO-A16089
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD126/IL6R/IL-6RA (SAA0048)
Clone Name SAA0048
Protein Name CD126/IL6R/IL-6RA (SAA0048)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16089-1MG
Uniprot ID P08887
Uniprot link P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms sIL6R, Interleukin-6 receptor subunit alpha, CD126, IL-6R 1, IL-6R subunit alpha, Membrane glycoprotein 80, gp80, IL6R, IL-6RA, IL-6 receptor subunit alpha, IL-6R-alpha
Reference ARO-A16089
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD126/IL6R/IL-6RA (SAA0048)
Clone Name SAA0048
Protein Name CD126/IL6R/IL-6RA (SAA0048)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16089-50
Uniprot ID P08887
Uniprot link P08887
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms sIL6R, Interleukin-6 receptor subunit alpha, CD126, IL-6R 1, IL-6R subunit alpha, Membrane glycoprotein 80, gp80, IL6R, IL-6RA, IL-6 receptor subunit alpha, IL-6R-alpha
Reference ARO-A16089
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD126/IL6R/IL-6RA (SAA0048)
Clone Name SAA0048
Protein Name CD126/IL6R/IL-6RA (SAA0048)
Target species Anti-Human Monoclonal Antibody

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody binds to Mouse CD126 recombinant protein in WB Assay

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody binds to Mouse CD126 recombinant protein in WB Assay

Mouse CD126 recombinant protein(cat. No.PX-P6391) can bind Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody in Western Blot Assay as detected on gel analysis.

Flow Cytometry results for Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

Flow Cytometry results for Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

Target Cells were stained with an irrelevant antibody or Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD126/IL6R/IL-6RA (SAA0048) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products