Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)

  • ARO-A13118-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €333.00.Current price is: €256.00.

50ug 23% OFF + 256 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)

Product name ARO-A13118-100
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Fusion glycoprotein F0, Fusion glycoprotein F2, F2, p27, Intervening segment, Pep27, Peptide 27, Fusion glycoprotein F1, F1, F, Human respiratory syncytial virus A (strain A2)
Reference ARO-A13118
Clonality Monoclonal Antibody
Protein Name Fusion glycoprotein F0
Product name ARO-A13118-1MG
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Fusion glycoprotein F0, Fusion glycoprotein F2, F2, p27, Intervening segment, Pep27, Peptide 27, Fusion glycoprotein F1, F1, F, Human respiratory syncytial virus A (strain A2)
Reference ARO-A13118
Clonality Monoclonal Antibody
Protein Name Fusion glycoprotein F0
Product name ARO-A13118-50
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-Fusion glycoprotein F0, Fusion glycoprotein F2, F2, p27, Intervening segment, Pep27, Peptide 27, Fusion glycoprotein F1, F1, F, Human respiratory syncytial virus A (strain A2)
Reference ARO-A13118
Clonality Monoclonal Antibody
Protein Name Fusion glycoprotein F0

SDS-PAGE for InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)

SDS-PAGE for InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)

InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19) binds to HRSV Fusion glycoprotein, N-His in ELISA Assay

InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19) binds to HRSV Fusion glycoprotein, N-His in ELISA Assay

HRSV Fusion glycoprotein, N-His(cat. No.ARO-P18673) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19) in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-HRSV F/Fusion glycoprotein F0 Antibody (RSV19)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products