Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037)

  • ARO-A16309
  • Validated ELISA
Note:
For research use only. Not suitable for human use.

380.00

100ug + 380 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037)

Product name Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037)
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human respiratory syncytial virus A (strain A2)
Aliases /Synonyms anti-Fusion glycoprotein F0, anti-Fusion glycoprotein F2, anti-F2, anti-p27, anti-Intervening segment, anti-Pep27, anti-Peptide 27, anti-Fusion glycoprotein F1, anti-F1, anti-F, anti-Human respiratory syncytial virus A (strain A2)
Reference ARO-A16309
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen F/Fusion glycoprotein F0
Clone Name SAA1037
Target species Anti-Human respiratory syncytial virus A (strain A2) Monoclonal Antibody

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037) binds to HRSV Fusion glycoprotein, N-His in ELISA Assay

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037) binds to HRSV Fusion glycoprotein, N-His in ELISA Assay

HRSV Fusion glycoprotein, N-His(cat. No.ARO-P18673) at 0.5µg/mL (100µL/well) can bind Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037) in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037)

SDS-PAGE for Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037)

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037)

There are no reviews yet.

Be the first to review “Anti-HRSV F/Fusion glycoprotein F0 VHH (SAA1037)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products