Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Trevogrumab Biosimilar – Anti-MSTN, GDF8 mAb – Research Grade

  • PX-TA1388-100UG
  • Validated ELISA WB
Isotype:
IgG4, Kappa

Original price was: €256.00.Current price is: €200.00.

100ug 22% OFF + 200 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb
Trevogrumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade in ELISA Assay
Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

Product name Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade
Uniprot ID O14793
Source CAS 1429201-24-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Trevogrumab,REGN-1033, REGN1033, SAR-391786,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1388
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade
Uniprot ID O14793
Source CAS 1429201-24-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Trevogrumab,REGN-1033, REGN1033, SAR-391786,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1388
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1388-50
Uniprot ID O14793
Source CAS 1429201-24-0
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Trevogrumab,REGN-1033, REGN1033, SAR-391786,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1388
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa

General information on Anti-MSTN/GDF8[Homo sapiens] (Trevogrumab) Monoclonal Antibody

Trevogrumab has been investigated for the treatment of Orthopedic disease and Sarcopenia.

SDS-PAGE for Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb

SDS-PAGE for Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb

Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Trevogrumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade in ELISA Assay

Trevogrumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade in ELISA Assay

Trevogrumab Biosimilar - Anti-MSTN;GDF8 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Trevogrumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

There are no reviews yet.

Be the first to review “Trevogrumab Biosimilar – Anti-MSTN, GDF8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products