Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human TNFSF15/TL1A recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O95150
Molecular weight:
23.37 kDa

379.00

100ug + 379 loyalty points
Ala71–Leu251 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human TNFSF15/TL1A recombinant protein

Human TNFSF15/TL1A recombinant protein

Product name Human TNFSF15/TL1A recombinant protein
Uniprot ID O95150
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence ALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Molecular weight 23.37 kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala71-Leu251
Aliases /Synonyms TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tumor necrosis factor ligand superfamily member 15, membrane form, Tumor necrosis factor ligand superfamily member 15, secreted form, TNFSF15, TL1, VEGITumor necrosis factor ligand superfamily member 15
Reference PX-P6413
Note For research use only.
Molecular Constructor
Ala71–Leu251 His

Introduction:

Tumor necrosis factor ligand superfamily member 15 (TNFSF15), also known as TNF ligand-related molecule 1 (TL1), is a cytokine that plays a crucial role in regulating immune responses and inflammation. It is a member of the TNF superfamily and is expressed on the surface of activated immune cells. In recent years, TNFSF15/TL1A has gained attention as a potential drug target for cancer treatment due to its ability to inhibit tumor growth and angiogenesis. In this article, we will delve into the structure, activity, and potential applications of TNFSF15/TL1A in both its membrane and secreted forms.

Structure of TNFSF15/TL1A:

TNFSF15/TL1A is a type II transmembrane protein, meaning it has an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain of TNFSF15/TL1A is responsible for binding to its receptor, death receptor 3 (DR3), which is expressed on the surface of various immune cells. The intracellular domain of TNFSF15/TL1A contains a death domain, which is important for initiating cell death signaling pathways.

Activity of TNFSF15/TL1A:

The main function of TNFSF15/TL1A is to regulate immune responses by promoting the proliferation and survival of T cells and natural killer (NK) cells. It also plays a role in promoting inflammation and angiogenesis. In addition, TNFSF15/TL1A has been found to have anti-tumor activity by inducing cell death in cancer cells and inhibiting tumor growth. This activity is mediated through its interaction with DR3, which leads to the activation of cell death pathways.

Potential Applications of TNFSF15/TL1A:

Given its role in regulating immune responses and inhibiting tumor growth, TNFSF15/TL1A has potential applications in cancer treatment. It has been shown to have anti-tumor activity in various types of cancer, including colorectal, breast, and lung cancer. Research has also shown that TNFSF15/TL1A can sensitize cancer cells to chemotherapy and radiation therapy, making it a potential adjuvant therapy for these treatments.

Membrane Form vs. Secreted Form:

TNFSF15/TL1A is expressed in both a membrane-bound form and a secreted form. The membrane-bound form is expressed on the surface of activated immune cells and is involved in cell-to-cell interactions. The secreted form, on the other hand, is released into the extracellular space and can act as a soluble cytokine. Both forms have been found to have anti-tumor activity, but the secreted form has been shown to be more potent in inducing cell death in cancer cells.

Human TNFSF15/TL1A Recombinant Protein:

In order to utilize the potential of TNFSF15/TL1A as a drug target, researchers have developed a human TNFSF15/TL1A recombinant protein. This protein is produced in a laboratory setting and can be used in experiments to study the effects of TNFSF15/TL1A on immune cells and cancer cells. It can also be used in the development of potential therapeutic agents that target TNFSF15/TL1A.

Conclusion:

In summary, TNFSF15/TL1A is a cytokine that plays a crucial role in regulating immune responses and inflammation. Its ability to inhibit tumor growth and angiogenesis has made it a potential drug target for cancer treatment. The structure and activity of TNFSF15/TL1A, both in its membrane and secreted forms, make it a promising candidate for the development of novel cancer therapies. Further research and clinical trials are needed to fully understand the potential of TNFSF15/TL1A and its recombinant protein in the treatment of cancer.

Human TNFSF15/TL1A recombinant protein

There are no reviews yet.

Be the first to review “Human TNFSF15/TL1A recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products