Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ID Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q96NW4
Molecular weight:
33,38 kDa

Original price was: €295.00.Current price is: €259.00.

50ug 12% OFF + 259 loyalty points
Partial GST
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ID Recombinant Protein

Product name Human ID Recombinant Protein
Uniprot ID Q96NW4
Uniprot link http://www.uniprot.org/uniprot/Q96NW4
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence (Sequence without tag) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSTSSFSSMSASSRQ EETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPE
Molecular weight 33,38 kDa
Protein delivered with Tag? GST
Purity estimated 50%
Buffer TrisHC 50mMl, pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_115515.2
Spec:Entrez GeneID 84079
Spec:NCBI Gene Aliases VARP, PP12899
Spec:SwissProtID Q96NW4
NCBI Reference NP_115515.2
Aliases /Synonyms ID, ankyrin repeat domain-containing protein 27, ANKRD27, VPS9 domain-containing protein, PP12899
Reference PX-P1117
Note For research use only
Molecular Constructor
Partial GST
Product name Human ID Recombinant Protein
Uniprot ID Q96NW4
Uniprot link http://www.uniprot.org/uniprot/Q96NW4
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence (Sequence without tag) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSTSSFSSMSASSRQ EETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPE
Molecular weight 33,38 kDa
Protein delivered with Tag? GST
Purity estimated 50%
Buffer TrisHC 50mMl, pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_115515.2
Spec:Entrez GeneID 84079
Spec:NCBI Gene Aliases VARP, PP12899
Spec:SwissProtID Q96NW4
NCBI Reference NP_115515.2
Aliases /Synonyms ID, ankyrin repeat domain-containing protein 27, ANKRD27, VPS9 domain-containing protein, PP12899
Reference PX-P1117
Note For research use only
Molecular Constructor
Partial GST
Product name PX-P1117-1MG
Uniprot ID Q96NW4
Uniprot link http://www.uniprot.org/uniprot/Q96NW4
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence (Sequence without tag) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSTSSFSSMSASSRQ EETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPE
Molecular weight 33,38 kDa
Protein delivered with Tag? GST
Purity estimated 50%
Buffer TrisHC 50mMl, pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_115515.2
Spec:Entrez GeneID 84079
Spec:NCBI Gene Aliases VARP, PP12899
Spec:SwissProtID Q96NW4
NCBI Reference NP_115515.2
Aliases /Synonyms ID, ankyrin repeat domain-containing protein 27, ANKRD27, VPS9 domain-containing protein, PP12899
Reference PX-P1117
Note For research use only
Molecular Constructor
Partial GST

Ankyrin repeat domain-containing protein 27 is a protein that in humans is encoded by the ANKRD27 gene.

Human ID Recombinant Protein

  • Hesketh GG, Pérez-Dorado I, Jackson LP, Wartosch L, Schäfer IB, Gray SR, McCoy AJ, Zeldin OB, Garman EF, Harbour ME, Evans PR, Seaman MN, Luzio JP, Owen DJ. VARP is recruited on to endosomes by direct interaction with retromer, where together they function in export to the cell surface. Dev Cell. 2014 Jun 9;29(5):591-606. doi: 10.1016/j.devcel.2014.04.010. Epub 2014 May 22. PubMed PMID: 24856514; PubMed Central PMCID: PMC4059916.
  • Schäfer IB, Hesketh GG, Bright NA, Gray SR, Pryor PR, Evans PR, Luzio JP, Owen DJ. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nat Struct Mol Biol. 2012 Dec;19(12):1300-9. doi: 10.1038/nsmb.2414. Epub 2012 Oct 28. PubMed PMID: 23104059; PubMed Central PMCID: PMC3605791.
  • Wang F, Zhang H, Zhang X, Wang Y, Ren F, Zhang X, Zhai Y, Chang Z. Varp interacts with Rab38 and functions as its potential effector. Biochem Biophys Res Commun. 2008 Jul 18;372(1):162-7. doi: 10.1016/j.bbrc.2008.05.017. Epub 2008 May 12. PubMed PMID: 18477474.
  • Yatsu A, Shimada H, Ohbayashi N, Fukuda M. Rab40C is a novel Varp-binding protein that promotes proteasomal degradation of Varp in melanocytes. Biol Open. 2015 Feb 6;4(3):267-75. doi: 10.1242/bio.201411114. PubMed PMID: 25661869; PubMed Central PMCID: PMC4359733.
  • Sleiman PM, Wang ML, Cianferoni A, Aceves S, Gonsalves N, Nadeau K, Bredenoord AJ, Furuta GT, Spergel JM, Hakonarson H. GWAS identifies four novel eosinophilic esophagitis loci. Nat Commun. 2014 Nov 19;5:5593. doi: 10.1038/ncomms6593. PubMed PMID: 25407941; PubMed Central PMCID: PMC4238044.
  • Zhang X, He X, Fu XY, Chang Z. Varp is a Rab21 guanine nucleotide exchange factor and regulates endosome dynamics. J Cell Sci. 2006 Mar 15;119(Pt 6):1053-62. PubMed PMID: 16525121.
  • Burgo A, Proux-Gillardeaux V, Sotirakis E, Bun P, Casano A, Verraes A, Liem RK, Formstecher E, Coppey-Moisan M, Galli T. A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery. Dev Cell. 2012 Jul 17;23(1):166-80. doi: 10.1016/j.devcel.2012.04.019. Epub 2012 Jun 14. PubMed PMID: 22705394.
  • Burgo A, Sotirakis E, Simmler MC, Verraes A, Chamot C, Simpson JC, Lanzetti L, Proux-Gillardeaux V, Galli T. Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. 2009 Oct;10(10):1117-24. doi: 10.1038/embor.2009.186. Epub 2009 Sep 11. PubMed PMID: 19745841; PubMed Central PMCID: PMC2759737.
  • GENDEP Investigators.; MARS Investigators.; STAR*D Investigators.. Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies. Am J Psychiatry. 2013 Feb;170(2):207-17. doi: 10.1176/appi.ajp.2012.12020237. PubMed PMID: 23377640.
  • Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J. Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. Erratum in: Proc Natl Acad Sci U S A. 2004 Dec 14:101(50):17565. PubMed PMID: 15498874; PubMed Central PMCID: PMC524842.
  • Simpson JC, Wellenreuther R, Poustka A, Pepperkok R, Wiemann S. Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing. EMBO Rep. 2000 Sep;1(3):287-92. PubMed PMID: 11256614; PubMed Central PMCID: PMC1083732.
  • Colland F, Jacq X, Trouplin V, Mougin C, Groizeleau C, Hamburger A, Meil A, Wojcik J, Legrain P, Gauthier JM. Functional proteomics mapping of a human signaling pathway. Genome Res. 2004 Jul;14(7):1324-32. PubMed PMID: 15231748; PubMed Central PMCID: PMC442148.
  • Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S. The LIFEdb database in 2006. Nucleic Acids Res. 2006 Jan 1;34(Database issue):D415-8. PubMed PMID: 16381901; PubMed Central PMCID: PMC1347501.
  • Wiemann S, Arlt D, Huber W, Wellenreuther R, Schleeger S, Mehrle A, Bechtel S, Sauermann M, Korf U, Pepperkok R, Sültmann H, Poustka A. From ORFeome to biology: a functional genomics pipeline. Genome Res. 2004 Oct;14(10B):2136-44. PubMed PMID: 15489336; PubMed Central PMCID: PMC528930.
  • Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Böcher M, Blöcker H, Bauersachs S, Blum H, Lauber J, Düsterhöft A, Beyer A, Köhrer K, Strack N, Mewes HW, Ottenwälder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A. Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. PubMed PMID: 11230166; PubMed Central PMCID: PMC311072.

There are no reviews yet.

Be the first to review “Human ID Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products