Cart (0 Items)
Your cart is currently empty.
View Products 
               
               
              | size | 100ug, 50ug | 
|---|---|
| Brand | ProteoGenix | 
| Product type | Recombinant Proteins | 
| Host Species | Escherichia coli (E. coli) | 
| Applications | Elisa, WB | 
| Product name | Human ID Recombinant Protein | 
|---|---|
| Uniprot ID | Q96NW4 | 
| Uniprot link | http://www.uniprot.org/uniprot/Q96NW4 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Prokaryotic expression | 
| Sequence | (Sequence without tag) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSTSSFSSMSASSRQ EETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPE | 
| Molecular weight | 33,38 kDa | 
| Protein delivered with Tag? | GST | 
| Purity estimated | 50% | 
| Buffer | TrisHC 50mMl, pH8 | 
| Form | liquid | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | 10-25 | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Escherichia coli (E.coli) | 
| Fragment Type | Partial | 
| Protein Accession | NP_115515.2 | 
| Spec:Entrez GeneID | 84079 | 
| Spec:NCBI Gene Aliases | VARP, PP12899 | 
| Spec:SwissProtID | Q96NW4 | 
| NCBI Reference | NP_115515.2 | 
| Aliases /Synonyms | ID, ankyrin repeat domain-containing protein 27, ANKRD27, VPS9 domain-containing protein, PP12899 | 
| Reference | PX-P1117 | 
| Note | For research use only | 
Ankyrin repeat domain-containing protein 27 is a protein that in humans is encoded by the ANKRD27 gene.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.