Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human Growth hormone 1 isoform 1 recombinant protein |
---|---|
Uniprot ID | B1A4G6 |
Uniprot link | http://www.uniprot.org/uniprot/B1A4G6 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF |
Molecular weight | 22.24kDa |
Protein delivered with Tag? | No |
Purity estimated | 90% |
Buffer | 50mM Tris-HCl pH 7.0, 150mM NaCl |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Aliases /Synonyms | GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B |
Reference | PX-P4003 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.