Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Apolizumab Biosimilar – Anti-HLA-DRB mAb – Research Grade

  • PX-TA1037-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: €172.00.Current price is: €140.00.

50ug 19% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Apolizumab Biosimilar - Anti-HLA-DRB mAb - Research Grade

Product name Apolizumab Biosimilar - Anti-HLA-DRB mAb - Research Grade
Uniprot ID P01911
Source CAS 267227-08-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Apolizumab,Hu1D10,HLA-DRB,anti-HLA-DRB
Reference PX-TA1037
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Apolizumab Biosimilar - Anti-HLA-DRB mAb - Research Grade
Uniprot ID P01911
Source CAS 267227-08-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Apolizumab,Hu1D10,HLA-DRB,anti-HLA-DRB
Reference PX-TA1037
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1037-50
Uniprot ID P01911
Source CAS 267227-08-7
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Apolizumab,Hu1D10,HLA-DRB,anti-HLA-DRB
Reference PX-TA1037
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

The Structure of Apolizumab Biosimilar – Anti-HLA-DRB mAb

Apolizumab Biosimilar – Anti-HLA-DRB mAb is a monoclonal antibody (mAb) that is designed to target the HLA-DRB protein. It is a biosimilar of the original Apolizumab, which was developed as a treatment for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. The biosimilar version is produced using recombinant DNA technology, making it highly specific and reproducible.

The mAb is composed of two identical heavy chains and two identical light chains, held together by disulfide bonds. The heavy chains consist of four constant regions (Fc) and one variable region (VH), while the light chains have two constant regions (CL) and one variable region (VL). The variable regions are responsible for the specificity of the mAb, as they bind to the target protein.

The Activity of Apolizumab Biosimilar – Anti-HLA-DRB mAb

As a biosimilar of Apolizumab, the Anti-HLA-DRB mAb has a similar mechanism of action. It binds to the HLA-DRB protein, which is found on the surface of immune cells, and blocks its activity. This protein is involved in the activation of T cells, which play a crucial role in autoimmune diseases. By targeting and inhibiting HLA-DRB, Apolizumab Biosimilar prevents the activation of T cells, reducing inflammation and tissue damage.

In addition, Apolizumab Biosimilar also has an immunomodulatory effect. It can stimulate regulatory T cells, which help to control the immune response and prevent the development of autoimmune diseases. This dual mechanism of action makes Apolizumab Biosimilar a promising treatment option for a wide range of autoimmune diseases.

The Application of Apolizumab Biosimilar – Anti-HLA-DRB mAb

Apolizumab Biosimilar – Anti-HLA-DRB mAb is currently being developed as a research grade product for use in preclinical studies. It is intended for use in in vitro and in vivo experiments to investigate the role of HLA-DRB in autoimmune diseases and to evaluate the efficacy of Apolizumab Biosimilar as a potential treatment.

In addition to its research applications, Apolizumab Biosimilar has the potential to be developed as a therapeutic agent. As a biosimilar of Apolizumab, it has already undergone extensive preclinical and clinical studies, demonstrating its safety and efficacy. If approved, it could provide a more affordable treatment option for patients with autoimmune diseases, as biosimilars are typically priced lower than the original biologic drug.

Conclusion

Apolizumab Biosimilar – Anti-HLA-DRB mAb is a promising research grade product that has the potential to be developed as a therapeutic agent for autoimmune diseases. Its specific structure and dual mechanism of action make it a highly targeted and effective treatment option. As research in this field continues, Apolizumab Biosimilar could play a significant role in improving the lives of patients with autoimmune diseases.

SDS-PAGE for Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade

SDS-PAGE for Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade

Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade

SEC-HPLC of Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade

Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Apolizumab Biosimilar - Anti-HLA-DRB mAb - Research Grade

There are no reviews yet.

Be the first to review “Apolizumab Biosimilar – Anti-HLA-DRB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products