Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human Growth hormone 1 isoform 1 recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
B1A4G6
Molecular weight:
22.24kDa

210.00

50ug + 210 loyalty points
Partial No
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human Growth hormone 1 isoform 1 recombinant protein

Product name Human Growth hormone 1 isoform 1 recombinant protein
Uniprot ID B1A4G6
Uniprot link http://www.uniprot.org/uniprot/B1A4G6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Molecular weight 22.24kDa
Protein delivered with Tag? No
Purity estimated 90%
Buffer 50mM Tris-HCl pH 7.0, 150mM NaCl
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B
Reference PX-P4003
Note For research use only
Molecular Constructor
Partial No
Product name Human Growth hormone 1 isoform 1 recombinant protein
Uniprot ID B1A4G6
Uniprot link http://www.uniprot.org/uniprot/B1A4G6
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence GPFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Molecular weight 22.24kDa
Protein delivered with Tag? No
Purity estimated 90%
Buffer 50mM Tris-HCl pH 7.0, 150mM NaCl
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms GH1, Growth hormone B5, HCG1749481, isoform CRA_s, GHB5, hCG_1749481, GH,GH-N,GHB5,GHN,Growth hormone 1,hGH-N,IGHD1B
Reference PX-P4003
Note For research use only
Molecular Constructor
Partial No

There are no reviews yet.

Be the first to review “Human Growth hormone 1 isoform 1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products