Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Alemtuzumab Biosimilar – Anti-CD52 mAb – Research Grade

  • PX-TA1035-50
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €169.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade

Product name Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade
Uniprot ID P31358
Source CAS 216503-57-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Alemtuzumab,Campath-1H,LDP-03,CD52,anti-CD52
Reference PX-TA1035
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade
Uniprot ID P31358
Source CAS 216503-57-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Alemtuzumab,Campath-1H,LDP-03,CD52,anti-CD52
Reference PX-TA1035
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1035-50
Uniprot ID P31358
Source CAS 216503-57-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Alemtuzumab,Campath-1H,LDP-03,CD52,anti-CD52
Reference PX-TA1035
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-CD52(Homo sapiens) (Alemtuzumab) Monoclonal Antibody

Alemtuzumab is a recombinant humanized monoclonal antibody (Campath-1H), which targets the 21-28 kD cell surface glycoprotein CD52. The Campath-1H antibody is of isotype IgG1, with human variable framework and constant regions, and a complementarity determining region derived from a murine (rat) monoclonal antibody (Campath-1G).

SDS-PAGE for Alemtuzumab Biosimilar - Anti-CD52 mAb

SDS-PAGE for Alemtuzumab Biosimilar - Anti-CD52 mAb

Alemtuzumab Biosimilar - Anti-CD52 mAb, on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade

Flow Cytometry results for Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade

There are no reviews yet.

Be the first to review “Alemtuzumab Biosimilar – Anti-CD52 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products