Brand: ProteoGenix

Human CSF3 / G-CSF recombinant protein

PX-P6039
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Human
Uniprot ID:: P09919
Molecular weight:: 21.28 kDa

€329.00

100ug + 329 loyalty points

His Thr31–Pro207

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human CSF3 / G-CSF recombinant protein

Product name	Human CSF3 / G-CSF recombinant protein
Uniprot ID	P09919
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Molecular weight	21.28 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>85% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Thr31-Pro207
Aliases /Synonyms	C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF
Reference	PX-P6039
Note	For research use only
Molecular Constructor	His Thr31–Pro207