Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ARHGDIA Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P52565
Molecular weight:
17.91 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Asn69–Asp204
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ARHGDIA Protein, N-His

Product name ARO-P12350-100
Uniprot ID P52565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn69-Asp204
Aliases /Synonyms Rho GDP-dissociation inhibitor 1, GDIA1, Rho GDI 1, Rho-GDI alpha, ARHGDIA
Reference ARO-P12350
Note For research use only.
Molecular Constructor
Asn69–Asp204
Product name ARO-P12350-1MG
Uniprot ID P52565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn69-Asp204
Aliases /Synonyms Rho GDP-dissociation inhibitor 1, GDIA1, Rho GDI 1, Rho-GDI alpha, ARHGDIA
Reference ARO-P12350
Note For research use only.
Molecular Constructor
Asn69–Asp204
Product name ARO-P12350-50
Uniprot ID P52565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence NVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Molecular weight 17.91 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn69-Asp204
Aliases /Synonyms Rho GDP-dissociation inhibitor 1, GDIA1, Rho GDI 1, Rho-GDI alpha, ARHGDIA
Reference ARO-P12350
Note For research use only.
Molecular Constructor
Asn69–Asp204

Introduction to Recombinant Human ARHGDIA Protein

Recombinant Human ARHGDIA Protein, also known as Rho GDP-dissociation inhibitor 1 (ARHGDIA), is a protein that plays an important role in regulating the activity of Rho GTPases. Rho GTPases are a family of proteins that are involved in various cellular processes such as cell migration, adhesion, and proliferation. ARHGDIA acts as an inhibitor of Rho GTPases, preventing their activation and subsequent downstream signaling. This protein has been extensively studied and has shown potential in various applications, making it a valuable tool in the field of biotechnology.

Structure of Recombinant Human ARHGDIA Protein

Recombinant Human ARHGDIA Protein is a 204 amino acid protein with a molecular weight of approximately 23 kDa. It belongs to the Rho GDI family and contains a conserved Rho GDI domain, which is responsible for binding to and inhibiting Rho GTPases. The protein also has a C-terminal basic region that is involved in membrane targeting and a N-terminal acidic region that is responsible for binding to phospholipids. The structure of ARHGDIA is highly conserved across different species, indicating its important role in cellular function.

Activity of Recombinant Human ARHGDIA Protein

The main activity of Recombinant Human ARHGDIA Protein is to inhibit the activity of Rho GTPases. Rho GTPases are molecular switches that cycle between an active GTP-bound state and an inactive GDP-bound state. In their active state, Rho GTPases regulate various cellular processes by interacting with downstream effector proteins. However, their uncontrolled activation can result in pathological conditions such as cancer and inflammation. ARHGDIA binds to the active form of Rho GTPases and prevents their interaction with effector proteins, thus inhibiting their downstream signaling. This activity of ARHGDIA is crucial for maintaining the balance of Rho GTPase signaling in cells.

Application of Recombinant Human ARHGDIA Protein

Recombinant Human ARHGDIA Protein has various applications in the field of biotechnology. One of its main applications is in cell migration and invasion assays. As Rho GTPases play a crucial role in cell migration, ARHGDIA can be used to inhibit their activity and study the effects on cell migration. This protein has also been used in cancer research, as Rho GTPases are known to be involved in tumor progression and metastasis. By inhibiting Rho GTPases with ARHGDIA, researchers can gain insights into the role of these proteins in cancer development and identify potential therapeutic targets.

In addition, Recombinant Human ARHGDIA Protein has been used in drug discovery and development. As Rho GTPases are involved in various disease processes, targeting them with small molecule inhibitors can have therapeutic potential. ARHGDIA can be used as a tool to screen and identify potential inhibitors of Rho GTPases, thus aiding in the development of new drugs.

Furthermore, ARHGDIA has also been studied for its potential in regulating immune responses. Rho GTPases are involved in the activation and migration of immune cells, and ARHGDIA has been shown to modulate these processes. This protein has been used in studies to understand the role of Rho GTPases in immune function and to develop potential immunotherapies.

Conclusion

Recombinant Human ARHGDIA Protein is a valuable tool in the field of biotechnology. Its ability to inhibit the activity of Rho GTPases makes it a versatile protein with various applications. From cell migration assays to cancer research and drug discovery, ARHGDIA has shown great potential in advancing our understanding of cellular processes and developing new therapies. With ongoing research and advancements

Recombinant Human ARHGDIA Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ARHGDIA Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products