Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054)

  • ARO-A13320-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €358.00.Current price is: €256.00.

50ug 28% OFF + 256 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054)

Product name ARO-A13320-100
Uniprot ID P09919
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF
Reference ARO-A13320
Clonality Monoclonal Antibody
Protein Name C17orf33
Product name ARO-A13320-1MG
Uniprot ID P09919
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF
Reference ARO-A13320
Clonality Monoclonal Antibody
Protein Name C17orf33
Product name ARO-A13320-50
Uniprot ID P09919
Raw Antigen Sequence MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-C17orf33, Lenograstim, CSF3, Pluripoietin, Filgrastim, Granulocyte colony-stimulating factor, GCSF, G-CSF
Reference ARO-A13320
Clonality Monoclonal Antibody
Protein Name C17orf33

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in ELISA Assay

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in ELISA Assay

Human CSF3 / G-CSF recombinant protein(cat. No.PX-P6039) at 0.5µg/mL (100µL/well) can bind InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) in indirect ELISA with Goat secondary antibody measured by OD450.

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in WB Assay

InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) binds to Human CSF3 / G-CSF recombinant protein in WB Assay

Human CSF3 / G-CSF recombinant protein(cat. No.PX-P6039) can bind InVivoMAb Anti-Human CSF3/G-CSF (Iv0054) in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human CSF3/G-CSF (Iv0054)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products