Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD70 Monoclonal Antibody

  • ARO-A15775-50
  • Validated ELISA FC

Original price was: €280.00.Current price is: €231.00.

50ug 18% OFF + 231 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD70 Monoclonal Antibody

Product name ARO-A15775-100
Uniprot ID P32970
Uniprot link P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD27 ligand, CD70, TNFSF7, CD27LG, CD27L, CD70 antigen, Tumor necrosis factor ligand superfamily member 7, CD27-L
Reference ARO-A15775
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD70
Clone Name h1F6
Protein Name CD70
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15775-1MG
Uniprot ID P32970
Uniprot link P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD27 ligand, CD70, TNFSF7, CD27LG, CD27L, CD70 antigen, Tumor necrosis factor ligand superfamily member 7, CD27-L
Reference ARO-A15775
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD70
Clone Name h1F6
Protein Name CD70
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15775-50
Uniprot ID P32970
Uniprot link P32970
Raw Antigen Sequence MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms CD27 ligand, CD70, TNFSF7, CD27LG, CD27L, CD70 antigen, Tumor necrosis factor ligand superfamily member 7, CD27-L
Reference ARO-A15775
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD70
Clone Name h1F6
Protein Name CD70
Target species Anti-Human Monoclonal Antibody

Human CD70 Monoclonal Antibody binds to Recombinant Human CD70 Protein, N-His in ELISA Assay

Human CD70 Monoclonal Antibody binds to Recombinant Human CD70 Protein, N-His in ELISA Assay

Recombinant Human CD70 Protein, N-His(cat. No.ARO-P10216) at 0.5µg/mL (100µL/well) can bind Human CD70 Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

Flow Cytometry results for Human CD70 Monoclonal Antibody

Flow Cytometry results for Human CD70 Monoclonal Antibody

Flow-cytometry using anti-human CD70 antibody. Untransfected cells (blue Histogram) and Transfected cells (Yellow Histogram) were stained with an anti-human CD70 monoclonal antibody (Catalog: ARO-A15775) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a Goat Anti-Human IgG H&L Polyclonal Antibody, FITC (abinScience: PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Human CD70 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD70 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products