Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD40 ligand recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P63304
Molecular weight:
17.95kDa

Original price was: €258.00.Current price is: €210.00.

50ug 19% OFF + 210 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD40 ligand recombinant protein

Product name Human CD40 ligand recombinant protein
Uniprot ID P63304
Uniprot link http://www.uniprot.org/uniprot/P63304
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH
Molecular weight 17.95kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms CD40L, CD154, TRAP, HIGM1, IGM, IMD3, TBAM, T-BAM, TNFSF5, Gp39, TNF Superfamily Member 5, Hyper-IgM Syndrome, TNF-Related Activation Protein, T-Cell B-Cell Activating Molecule
Reference PX-P4016
Note For research use only
Molecular Constructor
Partial Yes
Product name Human CD40 ligand recombinant protein
Uniprot ID P63304
Uniprot link http://www.uniprot.org/uniprot/P63304
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH
Molecular weight 17.95kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms CD40L, CD154, TRAP, HIGM1, IGM, IMD3, TBAM, T-BAM, TNFSF5, Gp39, TNF Superfamily Member 5, Hyper-IgM Syndrome, TNF-Related Activation Protein, T-Cell B-Cell Activating Molecule
Reference PX-P4016
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P4016-1MG
Uniprot ID P63304
Uniprot link http://www.uniprot.org/uniprot/P63304
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH
Molecular weight 17.95kDa
Protein delivered with Tag? Yes
Purity estimated 85%
Buffer 50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Aliases /Synonyms CD40L, CD154, TRAP, HIGM1, IGM, IMD3, TBAM, T-BAM, TNFSF5, Gp39, TNF Superfamily Member 5, Hyper-IgM Syndrome, TNF-Related Activation Protein, T-Cell B-Cell Activating Molecule
Reference PX-P4016
Note For research use only
Molecular Constructor
Partial Yes

Human CD40 ligand recombinant protein

There are no reviews yet.

Be the first to review “Human CD40 ligand recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products