Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human CD40 ligand recombinant protein |
---|---|
Uniprot ID | P63304 |
Uniprot link | http://www.uniprot.org/uniprot/P63304 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH |
Molecular weight | 17.95kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 85% |
Buffer | 50 mM Tris-HCl, pH 8.0, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Aliases /Synonyms | CD40L, CD154, TRAP, HIGM1, IGM, IMD3, TBAM, T-BAM, TNFSF5, Gp39, TNF Superfamily Member 5, Hyper-IgM Syndrome, TNF-Related Activation Protein, T-Cell B-Cell Activating Molecule |
Reference | PX-P4016 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.