Brand: ProteoGenix

Human CD272: B- and T-lymphocyte attenuator(BTLA) recombinant protein

PX-P4013-100
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q7Z6A9
Molecular weight:: 28.73kDa

Original price was: €483.00.Current price is: €420.00.

100ug 13% OFF + 420 loyalty points

Partial Yes

Size Size

50ug Original price was: €252.00.Current price is: €210.00.
100ug Original price was: €483.00.Current price is: €420.00.
1MG Original price was: €1,413.00.Current price is: €1,218.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Human CD272: B- and T-lymphocyte attenuator(BTLA) recombinant protein

Product name	Human CD272: B- and T-lymphocyte attenuator(BTLA) recombinant protein
Uniprot ID	Q7Z6A9
Uniprot link	http://www.uniprot.org/uniprot/Q7Z6A9
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASGSHHHHHH
Molecular weight	28.73kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Spec:Entrez GeneID	B- and T-lymphocyte attenuator
Aliases /Synonyms	CD272
Reference	PX-P4013
Note	For research use only
Molecular Constructor	Partial Yes

Product name	Human CD272: B- and T-lymphocyte attenuator(BTLA) recombinant protein
Uniprot ID	Q7Z6A9
Uniprot link	http://www.uniprot.org/uniprot/Q7Z6A9
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASGSHHHHHH
Molecular weight	28.73kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Spec:Entrez GeneID	B- and T-lymphocyte attenuator
Aliases /Synonyms	CD272
Reference	PX-P4013
Note	For research use only
Molecular Constructor	Partial Yes

Product name	PX-P4013-1MG
Uniprot ID	Q7Z6A9
Uniprot link	http://www.uniprot.org/uniprot/Q7Z6A9
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASGSHHHHHH
Molecular weight	28.73kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	50 mM Tris-HCl, pH 8.0, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Spec:Entrez GeneID	B- and T-lymphocyte attenuator
Aliases /Synonyms	CD272
Reference	PX-P4013
Note	For research use only
Molecular Constructor	Partial Yes