Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD126 Recombinant Protein

  • PX-P4104-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08887
Molecular weight:
65kDa

Original price was: €353.00.Current price is: €294.00.

50ug 17% OFF + 294 loyalty points
Met1~Pro365 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD126 Recombinant Protein

Product name PX-P4104-100
Uniprot ID P08887
Uniprot link http://www.uniprot.org/uniprot/P08887
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Molecular weight 65kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Pro365
Aliases /Synonyms /
Reference PX-P4104
Note For research use only.
Molecular Constructor
Met1~Pro365 His
Product name PX-P4104-1MG
Uniprot ID P08887
Uniprot link http://www.uniprot.org/uniprot/P08887
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Molecular weight 65kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Pro365
Aliases /Synonyms /
Reference PX-P4104
Note For research use only.
Molecular Constructor
Met1~Pro365 His
Product name PX-P4104-50
Uniprot ID P08887
Uniprot link http://www.uniprot.org/uniprot/P08887
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
Molecular weight 65kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Pro365
Aliases /Synonyms /
Reference PX-P4104
Note For research use only.
Molecular Constructor
Met1~Pro365 His

General Information about CD126 Recombinant Protein

The interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor.
Interleukin 6 (IL6) is an effective pleiotropic cytokine that can regulate cell differentiation and differentiation and plays an important role in the immune response. The unregulated production of IL6 and this receptor is involved in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer.
In melanocytes, IL6R gene expression can be regulated by MITF. The IL6 receptor is a protein complex composed of the ILUN-6 receptor subunit (IL6R) and the signal transduction glycoprotein 130 of interleukin 6. IL6R is also known as the human gene encoding this subunit. It is possible to report alternative transcription variants that encode different isoforms. The IL6R subunit is also shared by many other cytokines.

Sarilumab Biosimilar - Anti-IL-6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Sarilumab Biosimilar - Anti-IL-6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind to Sarilumab Biosimilar - Anti-IL-6R mAb (cat. No.PX-TA1028) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade binds to CD126 Recombinant Protein in ELISA assay

Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade binds to CD126 Recombinant Protein in ELISA assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind Levilimab Biosimilar - Anti-CD126;IL6R mAb - Research Grade (cat. No.PX-TA1545) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1.08M.

Satralizumab Biosimilar - Anti-IL6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Satralizumab Biosimilar - Anti-IL6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind to Satralizumab Biosimilar - Anti-IL6R mAb (cat. No.PX-TA1407) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Tocilizumab Biosimilar - Anti-IL-6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Tocilizumab Biosimilar - Anti-IL-6R mAb binds to CD126 Recombinant Protein in indirect ELISA Assay

Immobilized CD126 Recombinant Protein (cat. No.PX-P4104) at 0.5µg/mL (100µL/well) can bind to Tocilizumab Biosimilar - Anti-IL-6R mAb (cat. No.PX-TA1030) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

CD126 Recombinant Protein

There are no reviews yet.

Be the first to review “CD126 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products