Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Hnk20Mab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade

  • PX-TA1083-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgA-nd

Original price was: €178.00.Current price is: €140.00.

50ug 21% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Hnk20Mab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade

Product name Hnk20Mab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade
Uniprot ID P03420
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Hnk20Mab,HNK20,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgA-nd
Clonality Monoclonal Antibody
Product name Hnk20Mab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade
Uniprot ID P03420
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Hnk20Mab,HNK20,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgA-nd
Clonality Monoclonal Antibody
Product name PX-TA1083-50
Uniprot ID P03420
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Hnk20Mab,HNK20,RSV glycoprotein F,anti-RSV glycoprotein F
Reference PX-TA1083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgA-nd
Clonality Monoclonal Antibody

Introduction

Hnk20Mab Biosimilar is a research grade antibody that targets the respiratory syncytial virus (RSV) glycoprotein F. This monoclonal antibody (mAb) has been developed as a potential therapeutic for RSV infection, which is a major cause of respiratory illness in infants and young children. In this article, we will discuss the structure, activity, and potential applications of Hnk20Mab Biosimilar in the field of RSV research.

Structure of Hnk20Mab Biosimilar

Hnk20Mab Biosimilar is a humanized IgG1 monoclonal antibody that specifically binds to the fusion protein of RSV, glycoprotein F. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for its specificity and binds to a specific epitope on the RSV glycoprotein F. The constant region is responsible for the effector functions of the antibody, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Hnk20Mab Biosimilar

Hnk20Mab Biosimilar has been shown to effectively neutralize RSV infection in vitro by blocking the fusion of the virus with the host cell. This prevents the virus from entering and replicating in the cells, thus reducing the viral load and preventing the spread of infection. In addition, Hnk20Mab Biosimilar has also been shown to enhance the clearance of RSV-infected cells by activating the immune system through ADCC and CDC mechanisms. This results in the elimination of infected cells and further reduces the viral load.

Applications of Hnk20Mab Biosimilar

The primary application of Hnk20Mab Biosimilar is in the treatment of RSV infection. It can be used as a therapeutic agent in patients with severe RSV infection, especially in high-risk populations such as infants and young children. Hnk20Mab Biosimilar can also be used as a prophylactic treatment to prevent RSV infection in high-risk individuals, such as premature infants and immunocompromised patients.

In addition to its therapeutic applications, Hnk20Mab Biosimilar can also be used as a research tool in the field of RSV. It can be used to study the mechanism of RSV infection and the role of glycoprotein F in the viral life cycle. Hnk20Mab Biosimilar can also be used in diagnostic assays to detect the presence of RSV in patient samples.

Conclusion

Hnk20Mab Biosimilar is a promising antibody that specifically targets the RSV glycoprotein F and has shown potential in the treatment and prevention of RSV infection. Its unique structure and activity make it an effective therapeutic and research tool in the field of RSV. Further studies and clinical trials are needed to fully evaluate the potential of Hnk20Mab Biosimilar in the treatment of RSV infection and its potential use in other respiratory diseases.

SEC-HPLC of Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

SEC-HPLC of Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

SDS-PAGE for Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

SDS-PAGE for Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade

Anti-HRSV F;F protein Antibody (HNK20) Biosimilar - Anti-F;Fusion glycoprotein F0 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Hnk20Mab Biosimilar - Anti-RSV glycoprotein F mAb - Research Grade

There are no reviews yet.

Be the first to review “Hnk20Mab Biosimilar – Anti-RSV glycoprotein F mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products