Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Alpha-1-acid glycoprotein 2(ORM2)

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P19652
Molecular weight:
21.65 kDa

€122.00

100ug + 122 loyalty points
His Gln19–Ser201
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Alpha-1-acid glycoprotein 2(ORM2)

Alpha-1-acid glycoprotein 2(ORM2)

Product name Alpha-1-acid glycoprotein 2(ORM2)
Uniprot ID P19652
Uniprot link https://www.uniprot.org/uniprot/P19652
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQC FYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEA LDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES
Molecular weight 21.65 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln19-Ser201
Protein Accession P19652
Spec:Entrez GeneID 5005
Spec:NCBI Gene Aliases AGP2; AGP-B; AGP-B'
NCBI Reference P19652
Aliases /Synonyms AGP 2，Orosomucoid-2，OMD 2，AGP2
Reference PX-P4780
Note For research use only
Molecular Constructor
His Gln19–Ser201
Product name Alpha-1-acid glycoprotein 2(ORM2)
Uniprot ID P19652
Uniprot link https://www.uniprot.org/uniprot/P19652
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQC FYNSSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEA LDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEEGES
Molecular weight 21.65 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln19-Ser201
Protein Accession P19652
Spec:Entrez GeneID 5005
Spec:NCBI Gene Aliases AGP2; AGP-B; AGP-B'
NCBI Reference P19652
Aliases /Synonyms AGP 2，Orosomucoid-2，OMD 2，AGP2
Reference PX-P4780
Note For research use only
Molecular Constructor
His Gln19–Ser201

There are no reviews yet.

Be the first to review “Alpha-1-acid glycoprotein 2(ORM2)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products