Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gremubamab Biosimilar – Anti-PcrV and Psl mAb – Research Grade

Isotype:
VH-CH1-VH-V-KAPPA-CH2-CH3

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Gremubamab Biosimilar - Anti-PcrV and Psl mAb - Research Grade

Product name Gremubamab Biosimilar - Anti-PcrV mAb - Research Grade
Uniprot ID O30527
Source CAS 1800381-36-5
Species Homo sapiens,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gremubamab ,MEDI3902,PcrV,anti-PcrV
Reference PX-TA1591
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-CH1-VH-V-KAPPA-CH2-CH3
Clonality Monoclonal Antibody
Product name Gremubamab Biosimilar - Anti-PcrV mAb - Research Grade
Uniprot ID O30527
Source CAS 1800381-36-5
Species Homo sapiens,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gremubamab ,MEDI3902,PcrV,anti-PcrV
Reference PX-TA1591
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-CH1-VH-V-KAPPA-CH2-CH3
Clonality Monoclonal Antibody
Product name PX-TA1591-50
Uniprot ID O30527
Source CAS 1800381-36-5
Species Homo sapiens,Humanized
Expression system Mammalian cells
Raw Antigen Sequence MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gremubamab ,MEDI3902,PcrV, Psl,anti-PcrV and Psl
Reference PX-TA1591
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype VH-CH1-VH-V-KAPPA-CH2-CH3

Overview of Gremubamab Biosimilar as a Therapeutic Antibody

Gremubamab biosimilar is a research-grade therapeutic antibody developed to target key virulence determinants of Pseudomonas aeruginosa, one of the most clinically relevant opportunistic bacterial pathogens. This monoclonal antibody is designed to recognize two major surface-associated factors: PcrV, a structural component of the Type III Secretion System (T3SS), and Psl, a critical exopolysaccharide involved in biofilm formation. By simultaneously addressing acute virulence and biofilm-associated persistence, Gremubamab biosimilar represents a valuable tool for translational and preclinical research focused on anti-infective antibody strategies.

Structural Characteristics of the Anti-PcrV and Psl Monoclonal Antibody

Gremubamab biosimilar is a full-length IgG monoclonal antibody produced using recombinant expression systems to ensure high batch-to-batch consistency. Structurally, it comprises two identical heavy chains and two identical light chains forming a Y-shaped immunoglobulin architecture typical of IgG antibodies. The antigen-binding fragments (Fab regions) are engineered to specifically recognize conserved epitopes on PcrV and Psl, while the Fc region retains the canonical IgG structure, enabling interaction with immune effector mechanisms in experimental models. As a research-grade biosimilar, its sequence and binding properties are designed to closely mimic those of the reference antibody, supporting reproducible comparative studies.

Biological Activity and Mechanism of Action

The biological activity of this therapeutic antibody lies in its dual targeting mechanism. Binding to PcrV interferes with the assembly and function of the T3SS needle tip complex, a critical structure required for the injection of cytotoxic effector proteins into host cells. This inhibition reduces bacterial cytotoxicity and attenuates acute virulence. In parallel, recognition of Psl exopolysaccharide disrupts biofilm-associated processes by impairing bacterial adhesion, aggregation, and surface persistence. Together, these activities allow researchers to study how antibody-mediated neutralization can modulate both planktonic and biofilm-associated phenotypes of P. aeruginosa.

Applications in Research and Preclinical Studies

Gremubamab biosimilar is widely used as a research-grade reagent in microbiology, immunology, and infectious disease research. Typical applications include in vitro neutralization assays, biofilm inhibition studies, flow cytometry (FACS) detection of Psl expression, and mechanistic investigations of T3SS regulation. It is also employed in animal infection models to explore antibody-based intervention strategies and to evaluate synergistic effects with antibiotics. As a biosimilar, it is particularly valuable for comparative studies aimed at understanding structure–function relationships and benchmarking novel anti-Pseudomonas antibodies.

Relevance for Therapeutic Antibody Development

Beyond its immediate research applications, Gremubamab biosimilar provides important insights into the development of next-generation therapeutic antibodies against bacterial pathogens. By targeting virulence rather than bacterial viability, this antibody supports alternative anti-infective strategies that may reduce selective pressure for antibiotic resistance. Its dual specificity toward PcrV and Psl also highlights the potential of multi-target antibody approaches to address complex infection dynamics involving both acute and chronic disease states.

Conclusion

In summary, Gremubamab biosimilar is a structurally well-defined, biologically active anti-PcrV and Psl monoclonal antibody that serves as a powerful research-grade therapeutic antibody model. Its dual mechanism of action and broad applicability make it a valuable asset for advancing fundamental research and supporting the development of innovative antibody-based anti-infective therapies.

Gremubamab Biosimilar - Anti-PcrV and Psl mAb - Research Grade in ELISA Assay

Gremubamab Biosimilar - Anti-PcrV and Psl mAb - Research Grade in ELISA Assay

Gremubamab Biosimilar - Anti-PcrV and Psl mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Gremubamab  Biosimilar - Anti-PcrV and Psl mAb - Research Grade

  • Desveaux JM, Faudry E, Contreras-Martel C, et al. Neutralizing human monoclonal antibodies that target the PcrV component of the type III secretion system of <i>Pseudomonas aeruginosa</i> act through distinct mechanisms. Elife. 2026 Feb;14:RP105195. DOI: 10.7554/elife.105195. PMID: 41700594; PMCID: PMC12912723 https://doi.org/10.7554/elife.105195

There are no reviews yet.

Be the first to review “Gremubamab Biosimilar – Anti-PcrV and Psl mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products