Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Histone H3.1(HIST1H3A)

Host species:
Escherichia coli (E.coli)
Origin species:
General
Molecular weight:
16.47kDa

Original price was: €178.00.Current price is: €142.00.

100ug 20% OFF + 142 loyalty points
Met1~Ala136 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Histone H3.1(HIST1H3A)

Product name Histone H3.1(HIST1H3A)
Uniprot ID P68431/Q6LED0/Q6LBF0/P68433
Uniprot link https://www.uniprot.org/uniprot/P68431
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular weight 16.47kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Ala136
Protein Accession P68431
Spec:Entrez GeneID 8350
Spec:NCBI Gene Aliases H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A
NCBI Reference P68431
Aliases /Synonyms H3FJ
Reference PX-P4575
Note For research use only
Molecular Constructor
Met1~Ala136 His
Product name Histone H3.1(HIST1H3A)
Uniprot ID P68431/Q6LED0/Q6LBF0/P68433
Uniprot link https://www.uniprot.org/uniprot/P68431
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular weight 16.47kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Ala136
Protein Accession P68431
Spec:Entrez GeneID 8350
Spec:NCBI Gene Aliases H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A
NCBI Reference P68431
Aliases /Synonyms H3FJ
Reference PX-P4575
Note For research use only
Molecular Constructor
Met1~Ala136 His
Product name PX-P4575-1MG
Uniprot ID P68431/Q6LED0/Q6LBF0/P68433
Uniprot link https://www.uniprot.org/uniprot/P68431
Origin species General
Expression system Prokaryotic expression
Raw Antigen Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular weight 16.47kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1~Ala136
Protein Accession P68431
Spec:Entrez GeneID 8350
Spec:NCBI Gene Aliases H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A
NCBI Reference P68431
Aliases /Synonyms H3FJ
Reference PX-P4575
Note For research use only
Molecular Constructor
Met1~Ala136 His

Histone H3.1(HIST1H3A)

There are no reviews yet.

Be the first to review “Histone H3.1(HIST1H3A)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products