Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cytochrome c oxidase assembly factor 8(COA8)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
Q96IL0
Molecular weight:
21.3kDa

Original price was: €256.00.Current price is: €210.00.

50ug 18% OFF + 210 loyalty points
His Ala40–Asn206
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cytochrome c oxidase assembly factor 8(COA8)

Product name Cytochrome c oxidase assembly factor 8(COA8)
Uniprot ID Q96IL0
Uniprot link https://www.uniprot.org/uniprot/Q96IL0
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Molecular weight 21.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala40-Asn206
Protein Accession Q96IL0
Spec:Entrez GeneID 84334
Spec:NCBI Gene Aliases APOP; APOP1; APOPT1; MC4DN17; C14orf153
Spec:SwissProtID Q53G28
NCBI Reference Q96IL0
Aliases /Synonyms APOP1, APOPT1,APOP-1,Apoptogenic protein 1, mitochondrial
Reference PX-P4817
Note For research use only
Molecular Constructor
His Ala40–Asn206
Product name Cytochrome c oxidase assembly factor 8(COA8)
Uniprot ID Q96IL0
Uniprot link https://www.uniprot.org/uniprot/Q96IL0
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Molecular weight 21.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala40-Asn206
Protein Accession Q96IL0
Spec:Entrez GeneID 84334
Spec:NCBI Gene Aliases APOP; APOP1; APOPT1; MC4DN17; C14orf153
Spec:SwissProtID Q53G28
NCBI Reference Q96IL0
Aliases /Synonyms APOP1, APOPT1,APOP-1,Apoptogenic protein 1, mitochondrial
Reference PX-P4817
Note For research use only
Molecular Constructor
His Ala40–Asn206
Product name PX-P4817-1MG
Uniprot ID Q96IL0
Uniprot link https://www.uniprot.org/uniprot/Q96IL0
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Molecular weight 21.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala40-Asn206
Protein Accession Q96IL0
Spec:Entrez GeneID 84334
Spec:NCBI Gene Aliases APOP; APOP1; APOPT1; MC4DN17; C14orf153
Spec:SwissProtID Q53G28
NCBI Reference Q96IL0
Aliases /Synonyms APOP1, APOPT1,APOP-1,Apoptogenic protein 1, mitochondrial
Reference PX-P4817
Note For research use only
Molecular Constructor
His Ala40–Asn206

Cytochrome c oxidase assembly factor 8(COA8)

There are no reviews yet.

Be the first to review “Cytochrome c oxidase assembly factor 8(COA8)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products