Name: Cytochrome c oxidase assembly factor 8(COA8)
SKU: PX-P4817-10
Availability: InStock

Product name	Cytochrome c oxidase assembly factor 8(COA8)
Uniprot ID	Q96IL0
Uniprot link	https://www.uniprot.org/uniprot/Q96IL0
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGAPERGAERRDTAPSGVSRFCPPRKSCHDWIGPPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTESGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN
Molecular weight	21.3kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Ala40-Asn206
Protein Accession	Q96IL0
Spec:Entrez GeneID	84334
Spec:NCBI Gene Aliases	APOP; APOP1; APOPT1; MC4DN17; C14orf153
Spec:SwissProtID	Q53G28
NCBI Reference	Q96IL0
Aliases /Synonyms	APOP1, APOPT1,APOP-1,Apoptogenic protein 1, mitochondrial
Reference	PX-P4817
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Cytochrome c oxidase assembly factor 8(COA8)”

size

Clear

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product