Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Nuclear factor NF-kappa-B p105 subunit(NFKB1)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P19838
Molecular weight:
35.98kDa

€329.00

100ug + 329 loyalty points
His Asp40–Tyr349
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Nuclear factor NF-kappa-B p105 subunit(NFKB1)

Nuclear factor NF-kappa-B p105 subunit(NFKB1)

Product name Nuclear factor NF-kappa-B p105 subunit(NFKB1)
Uniprot ID P19838
Uniprot link https://www.uniprot.org/uniprot/P19838
Expression system Prokaryotic expression
Sequence MGTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYLEHHHHHH
Molecular weight 35.98kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Tyr349
Protein Accession P19838
Spec:Entrez GeneID 4790
Spec:NCBI Gene Aliases KBF1; EBP-1; NF-kB; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B1; NF-kappabeta
Spec:SwissProtID Q68D84
NCBI Reference P19838
Aliases /Synonyms DNA-binding factor KBF1,EBP-1,Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1,
Reference PX-P4764
Note For research use only
Molecular Constructor
His Asp40–Tyr349
Product name Nuclear factor NF-kappa-B p105 subunit(NFKB1)
Uniprot ID P19838
Uniprot link https://www.uniprot.org/uniprot/P19838
Expression system Prokaryotic expression
Sequence MGTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYLEHHHHHH
Molecular weight 35.98kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >80% by SDS-PAGE
Buffer PBS PH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Tyr349
Protein Accession P19838
Spec:Entrez GeneID 4790
Spec:NCBI Gene Aliases KBF1; EBP-1; NF-kB; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B1; NF-kappabeta
Spec:SwissProtID Q68D84
NCBI Reference P19838
Aliases /Synonyms DNA-binding factor KBF1,EBP-1,Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1,
Reference PX-P4764
Note For research use only
Molecular Constructor
His Asp40–Tyr349

There are no reviews yet.

Be the first to review “Nuclear factor NF-kappa-B p105 subunit(NFKB1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products