Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Golocdacimab Biosimilar – Anti-OLR1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €182.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade

Product name Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade
Uniprot ID P78380
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Golocdacimab,,OLR1,anti-OLR1
Reference PX-TA1846
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda
Clonality Monoclonal Antibody
Product name Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade
Uniprot ID P78380
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Golocdacimab,,OLR1,anti-OLR1
Reference PX-TA1846
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Lambda
Clonality Monoclonal Antibody
Product name PX-TA1846-50
Uniprot ID P78380
Species Homo Sapiens
Expression system XtenCHO
Raw Antigen Sequence MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Golocdacimab,,OLR1,anti-OLR1
Reference PX-TA1846
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Golocdacimab Biosimilar, also known as Anti-OLR1 mAb, is a monoclonal antibody that targets the oxidized low-density lipoprotein (oxLDL) receptor 1 (OLR1). It is a research grade antibody that has shown promising results in preclinical studies and is currently being investigated for its potential therapeutic applications. In this article, we will delve into the structure, activity, and potential applications of Golocdacimab Biosimilar.

Structure of Golocdacimab Biosimilar

Golocdacimab Biosimilar is a fully human monoclonal antibody, meaning it is derived from human cells and has a high affinity for its target. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa.

The variable regions of Golocdacimab Biosimilar are responsible for its specificity and binding to OLR1. These regions are highly diverse and unique to each antibody, allowing for precise targeting of specific molecules. The constant regions, on the other hand, are responsible for the effector functions of the antibody, such as activation of the immune system and clearance of targeted molecules.

Activity of Golocdacimab Biosimilar

Golocdacimab Biosimilar works by binding to OLR1, a receptor that is expressed on the surface of various cells, including endothelial cells, smooth muscle cells, and macrophages. OLR1 is known to play a crucial role in the development of atherosclerosis, a condition characterized by the buildup of plaque in the arteries. This receptor is responsible for the uptake of oxLDL, a type of cholesterol that is involved in the formation of atherosclerotic plaques.

By binding to OLR1, Golocdacimab Biosimilar blocks the uptake of oxLDL and prevents the formation of atherosclerotic plaques. It also promotes the clearance of existing plaques by activating immune cells to remove them. This mechanism of action makes Golocdacimab Biosimilar a potential therapeutic candidate for the treatment of atherosclerosis and its associated complications, such as heart attack and stroke.

Potential Applications of Golocdacimab Biosimilar

Golocdacimab Biosimilar is currently being investigated for its potential applications in the treatment of atherosclerosis. It has shown promising results in preclinical studies, demonstrating its ability to reduce plaque formation and promote plaque regression in animal models. In addition, Golocdacimab Biosimilar has also shown potential in reducing inflammation and improving endothelial function, which are important factors in the development and progression of atherosclerosis.

Aside from its potential use in atherosclerosis, Golocdacimab Biosimilar may also have applications in other diseases where OLR1 is involved, such as diabetic nephropathy and Alzheimer’s disease. Furthermore, as a fully human antibody, Golocdacimab Biosimilar has a lower risk of immune reactions and can potentially be used in combination with other therapies without causing adverse effects.

Conclusion

Golocdacimab Biosimilar, also known as Anti-OLR1 mAb, is a promising research grade antibody that targets OLR1, a receptor involved in the development of atherosclerosis. Its unique structure and mechanism of action make it a potential therapeutic candidate for the treatment of atherosclerosis and other diseases where OLR1 is involved. Further studies and clinical trials are needed to fully evaluate the efficacy and safety of Golocdacimab Biosimilar, but its potential applications make it an exciting area of research in the field of cardiovascular medicine.

SDS-PAGE for Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade

SDS-PAGE for Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade

Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Golocdacimab Biosimilar - Anti-OLR1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Golocdacimab Biosimilar – Anti-OLR1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products