Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

FOLR1 recombinant protein

  • PX-P5197-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P15328
Molecular weight:
23.1 kDa

Original price was: €290.00.Current price is: €223.00.

50ug 23% OFF + 223 loyalty points
Arg25–Ser234 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

FOLR1 recombinant protein

Product name PX-P5197-100
Uniprot ID P15328
Uniprot link https://www.uniprot.org/uniprot/P15328
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS
Molecular weight 23.1 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg25-Ser234
Protein Accession P15328
Aliases /Synonyms FOLR, Fr-alpha, Fra
Reference PX-P5197
Note For research use only
Molecular Constructor
Arg25–Ser234 His
Product name PX-P5197-1MG
Uniprot ID P15328
Uniprot link https://www.uniprot.org/uniprot/P15328
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS
Molecular weight 23.1 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg25-Ser234
Protein Accession P15328
Aliases /Synonyms FOLR, Fr-alpha, Fra
Reference PX-P5197
Note For research use only
Molecular Constructor
Arg25–Ser234 His
Product name PX-P5197-50
Uniprot ID P15328
Uniprot link https://www.uniprot.org/uniprot/P15328
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS
Molecular weight 23.1 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Arg25-Ser234
Protein Accession P15328
Aliases /Synonyms FOLR, Fr-alpha, Fra
Reference PX-P5197
Note For research use only
Molecular Constructor
Arg25–Ser234 His

General information on FOLR1 recombinant protein

Introduction to FOLR1 Recombinant Protein

FOLR1 (Folate Receptor 1) is a transmembrane glycoprotein that is expressed in a variety of tissues, including the placenta, kidney, and liver. It is involved in the transport of folate and other metabolites across the plasma membrane. FOLR1 recombinant protein is a synthetic version of the native FOLR1 protein.

Structure of FOLR1 Recombinant Protein

FOLR1 recombinant protein consists of a single polypeptide chain. The protein contains four extracellular domains, a transmembrane domain, and an intracellular domain. The extracellular domains are responsible for folate binding and the transmembrane domain is responsible for anchoring the protein to the plasma membrane.

Activity of FOLR1 Recombinant Protein

FOLR1 recombinant protein is capable of binding folate with high affinity and mediating its transport across the plasma membrane. The protein has also been shown to be involved in the regulation of cell proliferation and differentiation.

Farletuzumab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Farletuzumab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Immobilized FOLR1 recombinant protein (cat. No.PX-P5197) at 0.5µg/mL (100µL/well) can bind to Farletuzumab Biosimilar - Anti-FOLR1 mAb (cat. No.PX-TA1207) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Mirvetuximab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Mirvetuximab Biosimilar - Anti-FOLR1 mAb binds to FOLR1 recombinant protein in indirect ELISA Assay

Immobilized FOLR1 recombinant protein (cat. No.PX-P5197) at 0.5µg/mL (100µL/well) can bind to Mirvetuximab Biosimilar - Anti-FOLR1 mAb (cat. No.PX-TA1412) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

FOLR1 recombinant protein

There are no reviews yet.

Be the first to review “FOLR1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products