Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

U1 small nuclear ribonucleoprotein C(SNRPC)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
F6TFD9
Molecular weight:
18.3kDa

182.00

50ug + 182 loyalty points
His Met1–Arg159
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

U1 small nuclear ribonucleoprotein C(SNRPC)

Product name U1 small nuclear ribonucleoprotein C(SNRPC)
Uniprot ID F6TFD9
Uniprot link https://www.uniprot.org/uniprot/F6TFD9
Expression system Prokaryotic expression
Raw Antigen Sequence MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >60% by SDS-PAGE
Buffer 20 mM Tris-HCl,pH8.0, 100mM NaCl, 1mM DTT, 0.1mM EDTA, 10%glycerol,0.1%NaN3
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg159
Protein Accession F6TFD9
NCBI Reference F6TFD9
Aliases /Synonyms U1 snRNP C,SNRPC,U1-C,U1C
Reference PX-P4599
Note For research use only
Molecular Constructor
His Met1–Arg159
Product name U1 small nuclear ribonucleoprotein C(SNRPC)
Uniprot ID F6TFD9
Uniprot link https://www.uniprot.org/uniprot/F6TFD9
Expression system Prokaryotic expression
Raw Antigen Sequence MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >60% by SDS-PAGE
Buffer 20 mM Tris-HCl,pH8.0, 100mM NaCl, 1mM DTT, 0.1mM EDTA, 10%glycerol,0.1%NaN3
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg159
Protein Accession F6TFD9
NCBI Reference F6TFD9
Aliases /Synonyms U1 snRNP C,SNRPC,U1-C,U1C
Reference PX-P4599
Note For research use only
Molecular Constructor
His Met1–Arg159

U1 small nuclear ribonucleoprotein C(SNRPC)

There are no reviews yet.

Be the first to review “U1 small nuclear ribonucleoprotein C(SNRPC)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products