Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €175.00.Current price is: €140.00.

50ug 20% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade

Product name Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade
Uniprot ID P18627 & Q15116
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-PD1, Programmed cell death protein 1, Protein PD-1, hPD-1, PDCD1, CD279, LAG3, LAG-3, CD223
Reference PX-TA2074
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade
Uniprot ID P18627 & Q15116
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-PD1, Programmed cell death protein 1, Protein PD-1, hPD-1, PDCD1, CD279, LAG3, LAG-3, CD223
Reference PX-TA2074
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2074-50
Uniprot ID P18627 & Q15116
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-PD1, Programmed cell death protein 1, Protein PD-1, hPD-1, PDCD1, CD279, LAG3, LAG-3, CD223
Reference PX-TA2074
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction:

Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb – Research Grade is a novel biopharmaceutical product that has been developed for the treatment of various types of cancer. This biosimilar is a monoclonal antibody (mAb) that targets two important immune checkpoint proteins, PD1 and LAG3, which are known to play a crucial role in regulating the immune response against cancer cells. In this article, we will discuss the structure, activity, and potential applications of Tobemstomig Biosimilar in the field of cancer therapy.

Structure of Tobemstomig Biosimilar:

Tobemstomig Biosimilar is a recombinant humanized monoclonal antibody that is produced using advanced biotechnological techniques. The antibody is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The variable regions of the antibody are engineered to specifically bind to PD1 and LAG3 proteins, while the constant regions provide stability and effector functions.

Activity of Tobemstomig Biosimilar:

Tobemstomig Biosimilar exerts its therapeutic effect by targeting and blocking the PD1 and LAG3 proteins on the surface of immune cells. These proteins act as immune checkpoints, which regulate the activity of T cells, a type of immune cell that plays a crucial role in fighting cancer. By binding to PD1 and LAG3, Tobemstomig Biosimilar inhibits their function and prevents them from suppressing the immune response against cancer cells. This leads to the activation of T cells, which can then recognize and attack cancer cells more effectively.

Application of Tobemstomig Biosimilar:

Tobemstomig Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer, including melanoma, lung cancer, and bladder cancer. The antibody has the potential to be used as a monotherapy or in combination with other anticancer therapies, such as chemotherapy and other immunotherapies.

In addition to its therapeutic potential, Tobemstomig Biosimilar can also be used as a research tool for studying the role of PD1 and LAG3 in cancer development and progression. Its high specificity and binding affinity make it a valuable tool for investigating the mechanisms of immune checkpoint regulation and identifying potential biomarkers for predicting response to immunotherapy.

Conclusion:

Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb – Research Grade is a novel biopharmaceutical product that targets two important immune checkpoint proteins, PD1 and LAG3, for the treatment of cancer. Its unique structure and mechanism of action make it a promising candidate for cancer therapy, with potential applications in both monotherapy and combination therapy. Furthermore, its use as a research tool can provide valuable insights into the role of immune checkpoints in cancer and help in the development of more effective treatments.

SDS-PAGE for Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade

SDS-PAGE for Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade

Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products