Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD274 / PD-L1 / B7-H1, C-His, recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9NZQ7
Molecular weight:
33.28 kDa

420.00

100ug + 420 loyalty points
Met1–Arg238 His
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CD274 / PD-L1 / B7-H1, C-His, recombinant protein

Product name CD274 / PD-L1 / B7-H1, C-His, recombinant protein
Uniprot ID Q9NZQ7
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Molecular weight 33.28 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg238
Protein Accession Q9NZQ7
Reference PX-P5607
Note For research use only
Molecular Constructor
Met1–Arg238 His

General information on CD274 / PD-L1 / B7-H1, C-His, recombinant protein

CD274 / PD-L1 / B7-H1 Structure

CD274, also known as PD-L1 or B7-H1, is a type I transmembrane glycoprotein that is expressed on the surface of various cell types, including T cells, B cells, macrophages, dendritic cells, and some tumor cells. The extracellular domain of CD274 is composed of three immunoglobulin-like domains, while the intracellular domain contains a cytoplasmic tail that is important for the regulation of its activity.

CD274 / PD-L1 / B7-H1 Activity

CD274 acts as an inhibitory receptor that binds to its ligand, programmed death ligand 1 (PD-L1). This interaction between CD274 and PD-L1 results in the inhibition of T cell activation and proliferation, as well as the induction of anergy and apoptosis in T cells. In addition, CD274 can also bind to other ligands, including B7 family members, which can lead to the activation of T cells.

CD274 / PD-L1 / B7-H1 Application

CD274 has been studied extensively in the context of cancer immunotherapy, as it is often overexpressed on tumor cells.

CD274 / PD-L1 / B7-H1, C-His, recombinant protein

There are no reviews yet.

Be the first to review “CD274 / PD-L1 / B7-H1, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products