Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Porustobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA2083-100
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
Ig gamma1 VH-h-CH2-CH3 dimer

Original price was: €246.00.Current price is: €200.00.

100ug 19% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name Porustobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig gamma1 VH-h-CH2-CH3 dimer
Clonality Monoclonal Antibody
Product name Porustobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig gamma1 VH-h-CH2-CH3 dimer
Clonality Monoclonal Antibody
Product name PX-TA2083-50
Uniprot ID P16410
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA2083
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Ig gamma1 VH-h-CH2-CH3 dimer
Clonality Monoclonal Antibody

Introduction

Porustobart Biosimilar – Anti-CD152 mAb – Research Grade is a novel biosimilar antibody that targets the protein CD152. This antibody has been extensively studied for its structure, activity, and potential applications in the field of therapeutics. In this article, we will explore the various aspects of this biosimilar antibody in detail.

Structure of Anti-CD152 mAb

The Anti-CD152 mAb is a monoclonal antibody that specifically binds to the CD152 protein. It is a humanized antibody, which means that it is derived from human antibodies and has been modified to reduce the risk of immune reactions. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL) and one variable domain (VL).

The variable domains of both the heavy and light chains are responsible for binding to the CD152 protein. These domains contain a specific amino acid sequence that allows the antibody to recognize and bind to the target protein with high affinity. The constant domains, on the other hand, provide stability and effector functions to the antibody.

Activity of Anti-CD152 mAb

The primary activity of Anti-CD152 mAb is its ability to bind to the CD152 protein. CD152, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), is a cell surface receptor that plays a critical role in regulating the immune response. It is primarily expressed on the surface of T cells and acts as a negative regulator of T cell activation. By binding to CD152, Anti-CD152 mAb inhibits its function, leading to increased T cell activation and proliferation.

In addition to its primary activity, Anti-CD152 mAb also has other effector functions, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC). These functions allow the antibody to induce cell death in CD152-expressing cells, providing a potential mechanism for the treatment of certain diseases.

Applications of Anti-CD152 mAb

The unique structure and activity of Anti-CD152 mAb make it a promising therapeutic agent for various diseases. The primary application of this biosimilar antibody is in the treatment of autoimmune diseases. By inhibiting CD152, the antibody can modulate the immune response and reduce the symptoms of autoimmune diseases such as rheumatoid arthritis, multiple sclerosis, and lupus.

Anti-CD152 mAb also has potential applications in cancer therapy. CD152 is known to be upregulated in certain types of cancer, and its inhibition can enhance the anti-tumor immune response. This makes Anti-CD152 mAb a potential candidate for combination therapy with other cancer treatments.

Moreover, Anti-CD152 mAb is also being studied for its role in organ transplantation. By inhibiting CD152, the antibody can prevent the rejection of transplanted organs, making it a potential immunosuppressive agent.

Conclusion

In summary, Porustobart Biosimilar – Anti-CD152 mAb – Research Grade is a novel biosimilar antibody with a unique structure and activity. Its ability to bind to CD152 and modulate the immune response makes it a promising therapeutic agent for various diseases. With ongoing research and clinical trials, this biosimilar antibody has the potential to revolutionize the treatment of autoimmune diseases, cancer, and organ transplantation.

SDS-PAGE for Porustobart Biosimilar - Anti-CD152 mAb - Research Grade

SDS-PAGE for Porustobart Biosimilar - Anti-CD152 mAb - Research Grade

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade binds to Mouse CD152 recombinant protein in WB Assay

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade binds to Mouse CD152 recombinant protein in WB Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) can bind Porustobart Biosimilar - Anti-CD152 mAb - Research Grade in Western Blot Assay as detected on gel analysis.

Porustobart Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Porustobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products