Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efpegerglucagon Biosimilar – Anti-GLP-1(7-36) mAb – Research Grade

Uniprot ID:
P01275

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Efpegerglucagon Biosimilar - Anti-GLP-1(7-36) mAb - Research Grade

Product name PX-TA2156-50
Uniprot ID P01275
Source CAS: 2766774-81-4
Expression system XtenCHO
Raw Antigen Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2156
Note For research use only. Not suitable for human use.
Isotype Synthetic glucagon peptide analogue conjugated with human IgG4 Fc fragment
Product name Efpegerglucagon Biosimilar - Anti-GLP-1(7-36) mAb - Research Grade
Uniprot ID P01275
Source CAS: 2766774-81-4
Expression system XtenCHO
Raw Antigen Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2156
Note For research use only. Not suitable for human use.
Isotype Synthetic glucagon peptide analogue conjugated with human IgG4 Fc fragment
Product name Efpegerglucagon Biosimilar - Anti-GLP-1(7-36) mAb - Research Grade
Uniprot ID P01275
Source CAS: 2766774-81-4
Expression system XtenCHO
Raw Antigen Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2156
Note For research use only. Not suitable for human use.
Isotype Synthetic glucagon peptide analogue conjugated with human IgG4 Fc fragment

Introduction

Efpegerglucagon Biosimilar – Anti-GLP-1(7-36) mAb – Research Grade is a novel therapeutic antibody that targets the glucagon-like peptide 1 (GLP-1) receptor. This biosimilar is designed to mimic the activity of the endogenous GLP-1 hormone, which plays a crucial role in regulating glucose homeostasis and satiety. In this article, we will discuss the structure, activity, and potential applications of this promising biosimilar.

Structure of Efpegerglucagon Biosimilar

Efpegerglucagon Biosimilar is a monoclonal antibody (mAb) that specifically binds to the GLP-1 receptor. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains consist of a constant region and a variable region, while the light chains only have a variable region. The variable regions are responsible for binding to the GLP-1 receptor, while the constant regions provide stability and effector functions.

The structure of Efpegerglucagon Biosimilar is highly similar to the endogenous GLP-1 hormone, allowing it to bind to the GLP-1 receptor with high affinity. This structural similarity also minimizes the risk of immunogenicity, making it a safe and effective therapeutic option.

Activity of Efpegerglucagon Biosimilar

Once bound to the GLP-1 receptor, Efpegerglucagon Biosimilar activates downstream signaling pathways that regulate glucose metabolism and appetite. This includes the activation of adenylyl cyclase and subsequent production of cyclic adenosine monophosphate (cAMP), which leads to insulin secretion and inhibition of glucagon release from pancreatic cells. This results in improved glycemic control and reduced hyperglycemia in patients with diabetes.

In addition, Efpegerglucagon Biosimilar also exerts anorexigenic effects by stimulating the release of satiety hormones such as peptide YY (PYY) and glucagon-like peptide 2 (GLP-2). This can help in reducing food intake and promoting weight loss in obese individuals.

Therapeutic Applications

Efpegerglucagon Biosimilar has shown promising results in preclinical and clinical studies for the treatment of type 2 diabetes and obesity. In patients with type 2 diabetes, it has been shown to improve glycemic control, reduce body weight, and lower the risk of cardiovascular events. It has also been found to be well-tolerated and safe, with no significant adverse effects reported.

Moreover, Efpegerglucagon Biosimilar has the potential to be used in combination with other antidiabetic agents, such as insulin and oral hypoglycemic drugs, to achieve better glycemic control and reduce the risk of hypoglycemia. It may also be beneficial for patients with obesity and metabolic syndrome, as it can promote weight loss and improve metabolic parameters.

Conclusion

Efpegerglucagon Biosimilar – Anti-GLP-1(7-36) mAb – Research Grade is a promising therapeutic antibody that targets the GLP-1 receptor. Its structure and activity closely resemble the endogenous GLP-1 hormone, making it a safe and effective treatment option for type 2 diabetes and obesity. Further research and clinical trials are needed to fully evaluate its potential and expand its therapeutic applications.

Efpegerglucagon Biosimilar - Anti-GLP-1(7-36) mAb - Research Grade

There are no reviews yet.

Be the first to review “Efpegerglucagon Biosimilar – Anti-GLP-1(7-36) mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products