Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Eflimrufusp Alfa Biosimilar – Anti-VEGF fusion protein – Research Grade

Uniprot ID:
P09038 & P15692

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Eflimrufusp Alfa Biosimilar - Anti-VEGF fusion protein - Research Grade

Product name Eflimrufusp Alfa Biosimilar - Anti-VEGF fusion protein - Research Grade
Uniprot ID P09038 & P15692
Expression system XtenCHO
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-VEGF
Reference PX-TA2013
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) domain 2 fragment (132-232) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309) domain 3 fragment (227-327) - FGFR1 (fibroblast growth factor receptor 1, FLT2, KAL2) domains 2 and 3 fragment (150-361)]2 - IGHG1 Fc (Fragment constant)
Product name Eflimrufusp Alfa Biosimilar - Anti-VEGF fusion protein - Research Grade
Uniprot ID P09038 & P15692
Expression system XtenCHO
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-VEGF
Reference PX-TA2013
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) domain 2 fragment (132-232) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309) domain 3 fragment (227-327) - FGFR1 (fibroblast growth factor receptor 1, FLT2, KAL2) domains 2 and 3 fragment (150-361)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2013-50
Uniprot ID P09038 & P15692
Expression system XtenCHO
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-VEGF
Reference PX-TA2013
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) domain 2 fragment (132-232) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309) domain 3 fragment (227-327) - FGFR1 (fibroblast growth factor receptor 1, FLT2, KAL2) domains 2 and 3 fragment (150-361)]2 - IGHG1 Fc (Fragment constant)

The Structure of Eflimrufusp Alfa Biosimilar

Eflimrufusp Alfa Biosimilar is a fusion protein that is designed to target and inhibit the activity of vascular endothelial growth factor (VEGF). It is a biosimilar version of the anti-VEGF drug, Eflimrufusp Alfa, which is used for the treatment of various types of cancers and eye diseases.

The structure of Eflimrufusp Alfa Biosimilar is composed of two main components – a monoclonal antibody and a VEGF receptor-binding domain. The monoclonal antibody is derived from a hybridoma cell line and is specific for VEGF. It is designed to bind to VEGF with high affinity and prevent it from binding to its receptors on the surface of cells.

The VEGF receptor-binding domain is derived from the extracellular domain of VEGF receptor 1 (VEGFR-1) and is fused to the C-terminus of the monoclonal antibody. This domain is responsible for the inhibitory activity of Eflimrufusp Alfa Biosimilar. It binds to VEGF with high affinity and blocks its signaling pathway, thereby inhibiting the growth and survival of VEGF-dependent cells.

The Activity of Eflimrufusp Alfa Biosimilar

Eflimrufusp Alfa Biosimilar acts as a potent inhibitor of VEGF activity. VEGF is a key regulator of angiogenesis, the process of formation of new blood vessels. It plays a crucial role in the growth and maintenance of blood vessels, which is essential for the growth and survival of tumors. In addition, VEGF is also involved in the development of neovascularization, the abnormal formation of blood vessels in diseases such as wet age-related macular degeneration (AMD) and diabetic retinopathy.

Eflimrufusp Alfa Biosimilar blocks the binding of VEGF to its receptors, thereby preventing the activation of downstream signaling pathways that promote angiogenesis and neovascularization. This leads to the inhibition of tumor growth and the regression of abnormal blood vessels in the eye, making it an effective therapeutic option for cancer and eye diseases.

The Application of Eflimrufusp Alfa Biosimilar

Eflimrufusp Alfa Biosimilar has been extensively studied in preclinical and clinical trials and has shown promising results in the treatment of various types of cancers and eye diseases. It has been approved by regulatory authorities in several countries for the treatment of metastatic colorectal cancer, metastatic breast cancer, and non-small cell lung cancer.

In addition, Eflimrufusp Alfa Biosimilar has also been approved for the treatment of wet AMD and diabetic macular edema (DME), two leading causes of vision loss in the elderly population. It has demonstrated significant efficacy in reducing the progression of vision loss and improving visual acuity in patients with these conditions.

Moreover, Eflimrufusp Alfa Biosimilar has also shown potential in the treatment of other diseases such as diabetic nephropathy, psoriasis, and rheumatoid arthritis. Its ability to inhibit VEGF activity makes it a promising therapeutic option for a wide range of diseases that are characterized by abnormal angiogenesis and neovascularization.

Conclusion

In summary, Eflimrufusp Alfa Biosimilar is a fusion protein that targets and inhibits the activity of VEGF, a key regulator of angiogenesis and neovascularization. Its unique structure, composed of a monoclonal antibody and a VEGF receptor-binding domain, allows it to effectively block VEGF activity and inhibit the growth and survival of VEGF-dependent cells. Its application in the treatment of various cancers and eye diseases has shown promising results, making it a valuable addition to the arsenal of anti- cancer and anti-angiogenic therapies.

Eflimrufusp Alfa Biosimilar - Anti-VEGF fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Eflimrufusp Alfa Biosimilar – Anti-VEGF fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products