Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efmitermant alfa Biosimilar – Anti-GDF-8 fusion protein – Research Grade

Uniprot ID:
O14793

Original price was: €168.00.Current price is: €140.00.

50ug 17% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

Product name Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2039
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FST (follistatin)]2 - IGHG2 Fc (Fragment constant)
Product name Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2039
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FST (follistatin)]2 - IGHG2 Fc (Fragment constant)
Product name PX-TA2039-50
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2039
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FST (follistatin)]2 - IGHG2 Fc (Fragment constant)

Efmitermant alfa Biosimilar: A Promising Antibody for Targeting GDF-8 Introduction

Efmitermant alfa Biosimilar is a novel fusion protein that has gained significant attention in the field of biopharmaceuticals. It is a biosimilar of Efmitermant alfa, a recombinant protein used for the treatment of anemia associated with chronic kidney disease. This biosimilar is designed to target growth and differentiation factor 8 (GDF-8), a protein involved in regulating muscle growth and development. In this article, we will explore the structure, activity, and potential applications of Efmitermant alfa Biosimilar as a therapeutic antibody.

Structure of Efmitermant alfa Biosimilar

Efmitermant alfa Biosimilar is a fusion protein composed of two components: Efmitermant alfa and an anti-GDF-8 antibody. The Efmitermant alfa component is a glycosylated protein with a molecular weight of approximately 30 kDa. It is produced in Chinese hamster ovary (CHO) cells using recombinant DNA technology. The anti-GDF-8 antibody component is a monoclonal antibody that specifically binds to GDF-8 with high affinity. It is a human IgG1 antibody with a molecular weight of approximately 150 kDa.

The two components of Efmitermant alfa Biosimilar are linked together by a flexible linker peptide, resulting in a final molecular weight of approximately 180 kDa. This fusion protein has a similar structure to the native GDF-8 protein, allowing it to bind to GDF-8 with high specificity and potency.

Mechanism of Action

Efmitermant alfa Biosimilar exerts its therapeutic effects by inhibiting the activity of GDF-8. GDF-8 is a member of the transforming growth factor-beta (TGF-β) superfamily and plays a crucial role in regulating muscle growth and development. In healthy individuals, GDF-8 helps maintain muscle homeostasis by inhibiting muscle growth and promoting muscle atrophy. However, in certain disease conditions, such as cancer cachexia and muscular dystrophy, GDF-8 is overexpressed, leading to excessive muscle wasting.

By binding to GDF-8, Efmitermant alfa Biosimilar blocks its interaction with its receptor, preventing the downstream signaling cascade that promotes muscle atrophy. This results in increased muscle mass and improved muscle function, making it a promising therapeutic target for various muscle-related disorders.

Potential Applications

Efmitermant alfa Biosimilar has shown promising results in preclinical studies for the treatment of various muscle-related disorders. In a mouse model of cancer cachexia, treatment with Efmitermant alfa Biosimilar resulted in increased muscle mass and improved muscle function. In a mouse model of muscular dystrophy, it improved muscle strength and reduced muscle degeneration. These results suggest that Efmitermant alfa Biosimilar could be a potential therapeutic option for these conditions.

Furthermore, GDF-8 has also been implicated in other diseases, such as osteoporosis and type 2 diabetes. Inhibition of GDF-8 activity by Efmitermant alfa Biosimilar could potentially have beneficial effects in these diseases as well. Clinical trials are currently underway to evaluate the safety and efficacy of Efmitermant alfa Biosimilar in these conditions.

Conclusion

Efmitermant alfa Biosimilar is a novel fusion protein designed to target GDF-8, a protein involved in regulating muscle growth and development. Its unique structure and mechanism of action make it a promising therapeutic option for various muscle-related disorders. With ongoing research and clinical trials, Efmitermant alfa Biosimilar has the potential to improve the lives of patients suffering from these conditions.

SDS-PAGE for Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

SDS-PAGE for Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Efmitermant alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Efmitermant alfa Biosimilar – Anti-GDF-8 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products