Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Taldefgrobep alfa Biosimilar – Anti-GDF-8 fusion protein – Research Grade

Uniprot ID:
O14793

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

Product name Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2038
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - IGHG1 Fc (Fragment constant) - [peptidyl linker - Alternative to antigen receptors (domain scaffold: FN1 F10, fibronectin domain F10)]2
Product name Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2038
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - IGHG1 Fc (Fragment constant) - [peptidyl linker - Alternative to antigen receptors (domain scaffold: FN1 F10, fibronectin domain F10)]2
Product name PX-TA2038-50
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2038
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - IGHG1 Fc (Fragment constant) - [peptidyl linker - Alternative to antigen receptors (domain scaffold: FN1 F10, fibronectin domain F10)]2

Introduction to Taldefgrobep alfa Biosimilar – Anti-GDF-8 fusion protein

Taldefgrobep alfa Biosimilar, also known as Anti-GDF-8 fusion protein, is a novel biopharmaceutical that has shown promising results in pre-clinical studies as a potential therapeutic agent for various diseases. This fusion protein is a biosimilar of the well-known therapeutic antibody, Taldefgrobep alfa, which has been approved for the treatment of certain cancers. In this article, we will explore the structure, activity, and potential applications of Taldefgrobep alfa Biosimilar.

Structure of Taldefgrobep alfa Biosimilar

Taldefgrobep alfa Biosimilar is a fusion protein composed of two components – a monoclonal antibody and a growth differentiation factor 8 (GDF-8) inhibitor. The monoclonal antibody component is derived from Taldefgrobep alfa, while the GDF-8 inhibitor is a novel addition. This fusion protein is designed to specifically target GDF-8, a protein that plays a crucial role in cell growth and differentiation.

The monoclonal antibody component of Taldefgrobep alfa Biosimilar is a fully humanized IgG1 antibody, which has been engineered to have a high affinity for GDF-8. This antibody binds to GDF-8 with high specificity, preventing its interaction with its receptors and inhibiting its activity. The GDF-8 inhibitor component is a small molecule that binds to GDF-8 and blocks its signaling pathway, further enhancing the inhibitory effect of the antibody.

Activity of Taldefgrobep alfa Biosimilar

The main activity of Taldefgrobep alfa Biosimilar is the inhibition of GDF-8, which has been implicated in various diseases such as cancer, muscle wasting, and fibrosis. By blocking the activity of GDF-8, this fusion protein has the potential to slow down or even reverse disease progression.

In pre-clinical studies, Taldefgrobep alfa Biosimilar has shown promising results in inhibiting the growth of various cancer cell lines, including breast, lung, and prostate cancer. It has also been shown to reduce muscle wasting in animal models, making it a potential treatment for conditions such as cachexia and sarcopenia. Additionally, the GDF-8 inhibitory activity of this fusion protein has been found to have anti-fibrotic effects, making it a potential therapy for fibrotic diseases.

Title: Potential Applications of Taldefgrobep alfa Biosimilar

Taldefgrobep alfa Biosimilar has the potential to be used as a therapeutic agent for a wide range of diseases. Its specific targeting of GDF-8 makes it a promising candidate for the treatment of cancers that overexpress this protein. In addition, its ability to inhibit muscle wasting and fibrosis makes it a potential treatment for conditions associated with these pathologies.

Moreover, Taldefgrobep alfa Biosimilar can also be used as a research tool to study the role of GDF-8 in various diseases. Its high specificity and potency in inhibiting GDF-8 make it a valuable tool for understanding the mechanisms of GDF-8 signaling and its role in disease progression.

Conclusion:

In conclusion, Taldefgrobep alfa Biosimilar is a novel fusion protein that has the potential to be used as a therapeutic agent for various diseases. Its unique structure, comprising of a monoclonal antibody and a GDF-8 inhibitor, allows for specific and potent inhibition of GDF-8, a protein involved in several pathological processes. With promising results in pre-clinical studies, Taldefgrobep alfa Biosimilar holds great promise for the treatment of cancer, muscle wasting, and fibrotic diseases. Additionally, its potential as a research tool makes it a valuable asset in the study of GDF-8 signaling and its role in disease.

SDS-PAGE for Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

SDS-PAGE for Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Taldefgrobep alfa Biosimilar – Anti-GDF-8 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products