Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Trebananib Biosimilar – Anti-ANG-2 fusion protein – Research Grade

Uniprot ID:
O15123

Original price was: €256.00.Current price is: €200.00.

100ug 22% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade

Product name Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade
Uniprot ID O15123
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-ANG-2, ANGPT2, Angiopoietin-2
Reference PX-TA2036
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IGHG1 Fc (Fragment constant) - [peptide 14-mer - peptide 14-mer]2]
Product name Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade
Uniprot ID O15123
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-ANG-2, ANGPT2, Angiopoietin-2
Reference PX-TA2036
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IGHG1 Fc (Fragment constant) - [peptide 14-mer - peptide 14-mer]2]
Product name PX-TA2036-50
Uniprot ID O15123
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-ANG-2, ANGPT2, Angiopoietin-2
Reference PX-TA2036
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IGHG1 Fc (Fragment constant) - [peptide 14-mer - peptide 14-mer]2]

The Structure of Trebananib Biosimilar

Trebananib Biosimilar, also known as Anti-ANG-2 fusion protein, is a research grade antibody that has been developed as a potential therapeutic agent for various diseases. This biosimilar is a recombinant fusion protein that is composed of two distinct domains: the anti-angiopoietin 2 (ANG-2) antibody and the Fc region of human immunoglobulin G1 (IgG1). The ANG-2 antibody component is responsible for the specific binding and inhibition of the angiopoietin 2 protein, while the Fc region provides stability and effector functions.

The ANG-2 antibody domain of Trebananib Biosimilar is a monoclonal antibody that has been engineered to target and bind to the angiopoietin 2 protein. This protein is a key regulator of blood vessel formation and has been implicated in various diseases, including cancer, inflammation, and cardiovascular disorders. The antibody domain of Trebananib Biosimilar binds to the angiopoietin 2 protein with high affinity and specificity, effectively blocking its activity and preventing the formation of new blood vessels.

The Fc region of Trebananib Biosimilar is derived from human IgG1 and is responsible for providing stability and effector functions to the molecule. The Fc region allows for the biosimilar to have a longer half-life in the body, increasing its duration of action. It also has the ability to interact with immune cells and trigger antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which can help in the destruction of target cells.

Activity of Trebananib Biosimilar

Trebananib Biosimilar has been designed to specifically target and inhibit the activity of angiopoietin 2, a protein that plays a crucial role in blood vessel formation. By blocking the activity of angiopoietin 2, this biosimilar can inhibit the growth and development of new blood vessels, a process known as angiogenesis. This is particularly important in diseases where abnormal blood vessel formation is a key factor, such as cancer and inflammation.

In addition to its anti-angiogenic activity, Trebananib Biosimilar also has effector functions through its Fc region. This allows the biosimilar to interact with immune cells and trigger their cytotoxic activity, leading to the destruction of target cells. This can be beneficial in diseases where abnormal cells need to be eliminated, such as cancer.

Applications of Trebananib Biosimilar

Trebananib Biosimilar has been primarily developed as a potential therapeutic agent for cancer. Angiogenesis is a critical process in tumor growth and metastasis, and by inhibiting angiopoietin 2, Trebananib Biosimilar has the potential to prevent the growth and spread of cancer cells. This biosimilar has shown promising results in pre-clinical studies and is currently being evaluated in clinical trials for various types of cancer, including ovarian, colorectal, and lung cancer.

Apart from

cancer, Trebananib Biosimilar has also shown potential in other diseases where angiogenesis and inflammation play a role. This includes diseases such as age-related macular degeneration, diabetic retinopathy, and rheumatoid arthritis. By inhibiting angiopoietin 2, this biosimilar can potentially reduce abnormal blood vessel formation and inflammation, leading to improved outcomes for patients.

In conclusion, Trebananib Biosimilar is a promising research grade antibody that has been designed to target and inhibit the activity of angiopoietin 2, a protein involved in blood vessel formation. With its anti-angiogenic and effector functions, this biosimilar has potential applications in various diseases, particularly cancer. Further research and clinical trials are needed to fully understand the potential of Trebananib Biosimilar and its role in improving patient outcomes.

SDS-PAGE for Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade

SDS-PAGE for Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade

Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Trebananib Biosimilar - Anti-ANG-2 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Trebananib Biosimilar – Anti-ANG-2 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products