Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

DNA topoisomerase 3-alpha (TOP3A)

Host species:
Insect
Uniprot ID:
Q9LVP1
Molecular weight:
35.29kDa

Original price was: €335.00.Current price is: €294.00.

50ug 12% OFF + 294 loyalty points
Glu631–Phe926
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

DNA topoisomerase 3-alpha (TOP3A)

Product name PX-P4289-100
Uniprot ID Q9LVP1
Uniprot link https://www.uniprot.org/uniprot/Q9LVP1
Expression system Eukaryotic expression
Raw Antigen Sequence ESQTAGEVVRRCNLCNESDMALRKNRDGNFMVGCMNYPQCRNAVWLPGPTLEASVTTNVCQSCGPGPVYKILFKFRQIGIPPGFDVNHLGCVGGCDDILKQLIDICGTGSRSQARRTPGTAPSNNIQGSNTRQSNVCIHCQQRGHASTNCPSRVPASRNSRPTATNPRNDESTVSCNTCGSQCVLRTANTEANRGRQFFSCPTQGCSFFAWEDSINNSSGNATTGSNSGGSGRRGSRGRGRGGRGGQSSGGRRGSGTSFVSATGEPVSGIRCFSCGDPSHFANACPNRNNSNGNYF
Molecular weight 35.29kDa
Purity estimated >90% by SDS-PAGE
Buffer 50mM Tris-Cl pH 8.0, 150mM NaCl.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Glu631-Phe926
Aliases /Synonyms /
Reference PX-P4289
Note For research use only
Molecular Constructor
Glu631–Phe926
Product name PX-P4289-1MG
Uniprot ID Q9LVP1
Uniprot link https://www.uniprot.org/uniprot/Q9LVP1
Expression system Eukaryotic expression
Raw Antigen Sequence ESQTAGEVVRRCNLCNESDMALRKNRDGNFMVGCMNYPQCRNAVWLPGPTLEASVTTNVCQSCGPGPVYKILFKFRQIGIPPGFDVNHLGCVGGCDDILKQLIDICGTGSRSQARRTPGTAPSNNIQGSNTRQSNVCIHCQQRGHASTNCPSRVPASRNSRPTATNPRNDESTVSCNTCGSQCVLRTANTEANRGRQFFSCPTQGCSFFAWEDSINNSSGNATTGSNSGGSGRRGSRGRGRGGRGGQSSGGRRGSGTSFVSATGEPVSGIRCFSCGDPSHFANACPNRNNSNGNYF
Molecular weight 35.29kDa
Purity estimated >90% by SDS-PAGE
Buffer 50mM Tris-Cl pH 8.0, 150mM NaCl.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Glu631-Phe926
Aliases /Synonyms /
Reference PX-P4289
Note For research use only
Molecular Constructor
Glu631–Phe926
Product name PX-P4289-50
Uniprot ID Q9LVP1
Uniprot link https://www.uniprot.org/uniprot/Q9LVP1
Expression system Eukaryotic expression
Raw Antigen Sequence ESQTAGEVVRRCNLCNESDMALRKNRDGNFMVGCMNYPQCRNAVWLPGPTLEASVTTNVCQSCGPGPVYKILFKFRQIGIPPGFDVNHLGCVGGCDDILKQLIDICGTGSRSQARRTPGTAPSNNIQGSNTRQSNVCIHCQQRGHASTNCPSRVPASRNSRPTATNPRNDESTVSCNTCGSQCVLRTANTEANRGRQFFSCPTQGCSFFAWEDSINNSSGNATTGSNSGGSGRRGSRGRGRGGRGGQSSGGRRGSGTSFVSATGEPVSGIRCFSCGDPSHFANACPNRNNSNGNYF
Molecular weight 35.29kDa
Purity estimated >90% by SDS-PAGE
Buffer 50mM Tris-Cl pH 8.0, 150mM NaCl.
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Glu631-Phe926
Aliases /Synonyms /
Reference PX-P4289
Note For research use only
Molecular Constructor
Glu631–Phe926

General information on DNA topoisomerase 3-alpha (TOP3A):

DNA topoisomerase 3-alpha is an enzyme encoded by the TOP3A gene in humans. This gene encodes DNA topoisomerase, an enzyme that controls and changes the topological state of DNA during transcription. This enzyme catalyzes the instantaneous breaking and agglomeration of single strands of DNA, which allows strands to cross each other, thereby reducing the number of supershells and altering the topological structure of DNA. The enzyme forms a complex with BLM, which can regulate the reorganization of somatic cells.

DNA topoisomerase 3-alpha (TOP3A)

There are no reviews yet.

Be the first to review “DNA topoisomerase 3-alpha (TOP3A)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products