Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
Brand: ProteoGenix

Genome polyprotein (691-1029)

Host species:
Insect
Uniprot ID:
P21530
Molecular weight:
41.57kDa

€210.00

50ug + 210 loyalty points
Leu691–Ala1029
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Genome polyprotein (691-1029)

Genome polyprotein (691-1029)

Product name Genome polyprotein (691-1029)
Uniprot ID P21530
Uniprot link https://www.uniprot.org/uniprot/P21530
Expression system Eukaryotic expression
Sequence MKFLVNVALVFMVVYISYIYAGSHHHHHHSGQLACKEDYRYAISSTNEIGLLGAGGLTTTWKEYNHDLQLNDGTVKAICVAGSFKVTALNVVSRRYLASLHKEALPTSVTFELLFDGTNPSTEEMGDDFGFGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRRDKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGLVKQCRWCGFDFNEPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISTEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPVRKTSCTFNYAKTLKNKYYEPRDSYFQQYMLKGEYQYWFDLDVTDRHSDYFAG
Molecular weight 41.57kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Leu691-Ala1029
Aliases /Synonyms /
Reference PX-P4283
Note For research use only
Molecular Constructor
Leu691–Ala1029
Product name Genome polyprotein (691-1029)
Uniprot ID P21530
Uniprot link https://www.uniprot.org/uniprot/P21530
Expression system Eukaryotic expression
Sequence MKFLVNVALVFMVVYISYIYAGSHHHHHHSGQLACKEDYRYAISSTNEIGLLGAGGLTTTWKEYNHDLQLNDGTVKAICVAGSFKVTALNVVSRRYLASLHKEALPTSVTFELLFDGTNPSTEEMGDDFGFGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRRDKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGLVKQCRWCGFDFNEPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISTEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPVRKTSCTFNYAKTLKNKYYEPRDSYFQQYMLKGEYQYWFDLDVTDRHSDYFAG
Molecular weight 41.57kDa
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Leu691-Ala1029
Aliases /Synonyms /
Reference PX-P4283
Note For research use only
Molecular Constructor
Leu691–Ala1029

There are no reviews yet.

Be the first to review “Genome polyprotein (691-1029)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products