Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bexatamig Biosimilar – Anti-CD123;CD335 mAb – Research Grade

  • PX-TA2177-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
Ig (H-gamma1-VH-G1CH1h_L-kappa)_L-kappa G1hCH2CH3

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Bexatamig Biosimilar - Anti-CD123;CD335 mAb - Research Grade

Product name PX-TA2177-50
Uniprot ID P26951 & O76036
Source Bispecific, CAS: 2871775-98-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference PX-TA2177-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1-VH-G1CH1h_L-kappa)_L-kappa G1hCH2CH3
Clonality Monoclonal Antibody
Product name Bexatamig Biosimilar - Anti-CD123;CD335 mAb - Research Grade
Uniprot ID P26951 & O76036
Source Bispecific, CAS: 2871775-98-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference PX-TA2177-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1-VH-G1CH1h_L-kappa)_L-kappa G1hCH2CH3
Clonality Monoclonal Antibody
Product name Bexatamig Biosimilar - Anti-CD123;CD335 mAb - Research Grade
Uniprot ID P26951 & O76036
Source Bispecific, CAS: 2871775-98-1
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL-3R subunit alpha, IL-3 receptor subunit alpha, CD123, Interleukin-3 receptor subunit alpha, IL3R, IL-3R-alpha, IL3RA, IL-3RA, LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference PX-TA2177-100
Note For research use only. Not suitable for human use.
Isotype Ig (H-gamma1-VH-G1CH1h_L-kappa)_L-kappa G1hCH2CH3
Clonality Monoclonal Antibody

Introduction
Bexatamig Biosimilar – Anti-CD123;CD335 mAb – Research Grade is a therapeutic antibody that targets two important receptors, CD123 and CD335, on the surface of cancer cells. This biosimilar is designed to mimic the structure and function of the original therapeutic antibody, Bexatamig, and is used in cancer research to understand the role of CD123 and CD335 in cancer progression and to develop new therapies.

Structure
Bexatamig Biosimilar is a monoclonal antibody, which means it is produced from a single type of immune cell. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains contain the antigen-binding region, which recognizes and binds to CD123 and CD335 on the surface of cancer cells. The light chains are responsible for stabilizing the structure of the antibody.

Activity
Bexatamig Biosimilar works by binding to CD123 and CD335 receptors on the surface of cancer cells. CD123 is a type of interleukin-3 receptor, which is found on the surface of leukemic stem cells and is involved in cell proliferation and survival. CD335, also known as natural killer cell receptor, is found on the surface of natural killer cells, a type of immune cell that plays a crucial role in fighting cancer.

By binding to these receptors, Bexatamig Biosimilar blocks the signaling pathways that promote cancer cell growth and survival. It also activates natural killer cells to attack and kill cancer cells, leading to tumor regression. This mechanism of action makes Bexatamig Biosimilar a promising therapeutic antibody for the treatment of various types of cancer.

Application
Bexatamig Biosimilar – Anti-CD123;CD335 mAb – Research Grade has multiple applications in cancer research. Firstly, it can be used to study the role of CD123 and CD335 in cancer progression. By blocking these receptors, researchers can observe the effects on cancer cell growth and survival, providing valuable insights into the underlying mechanisms of cancer.

Secondly, Bexatamig Biosimilar can be used to develop new therapies targeting CD123 and CD335. By understanding the structure and activity of this biosimilar, researchers can design more effective and specific therapeutic antibodies for the treatment of cancer.

Furthermore, Bexatamig Biosimilar can also be used in pre-clinical studies to assess its safety and efficacy before being tested in clinical trials. This is an important step in the drug development process to ensure that the biosimilar is safe and effective for use in humans.

Conclusion
In summary, Bexatamig Biosimilar – Anti-CD123;CD335 mAb – Research Grade is a therapeutic antibody that targets CD123 and CD335 receptors on the surface of cancer cells. Its structure and activity make it a promising candidate for cancer research and the development of new therapies. By understanding the role of CD123 and CD335 in cancer, researchers can use this biosimilar to advance our knowledge and improve treatment options for cancer patients.

SDS-PAGE for Bexatamig Biosimilar - Research Grade

SDS-PAGE for Bexatamig Biosimilar - Research Grade

Bexatamig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Bexatamig Biosimilar - Research Grade in WB Assay

Bexatamig Biosimilar - Research Grade in WB Assay

Bexatamig Biosimilar - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

There are no reviews yet.

Be the first to review “Bexatamig Biosimilar – Anti-CD123;CD335 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products