Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ciona intestinalis SLC Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Ciona intestinalis
Uniprot ID:
T2DR23
Molecular weight:
12,97 kDa

Original price was: €290.00.Current price is: €259.00.

50ug 11% OFF + 259 loyalty points
Partial Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Ciona intestinalis SLC Recombinant Protein

Product name Ciona intestinalis SLC Recombinant Protein
Uniprot ID T2DR23
Uniprot link http://www.uniprot.org/uniprot/T2DR23
Origin species Ciona intestinalis
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLLDGRAPIKHVIIDMSACSFIDNDAVKTFSSIHDDLSKLGIKLLLADCRNYVRKCFQAGNFGLSEKEDSP EGATPTPVFFISVTAALTYARTDDVTSDDPITANDVDD
Molecular weight 12,97 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 200mM if native conditions. PBS, imidazole 10mM, Urea 5M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AGV55623.1
Spec:SwissProtID T2DR23
NCBI Reference AGV55623.1
Aliases /Synonyms SLC, sulfate transporter Ci-Slc26a alpha
Reference PX-P1150
Note For research use only
Molecular Constructor
Partial Yes
Product name Ciona intestinalis SLC Recombinant Protein
Uniprot ID T2DR23
Uniprot link http://www.uniprot.org/uniprot/T2DR23
Origin species Ciona intestinalis
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLLDGRAPIKHVIIDMSACSFIDNDAVKTFSSIHDDLSKLGIKLLLADCRNYVRKCFQAGNFGLSEKEDSP EGATPTPVFFISVTAALTYARTDDVTSDDPITANDVDD
Molecular weight 12,97 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 200mM if native conditions. PBS, imidazole 10mM, Urea 5M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AGV55623.1
Spec:SwissProtID T2DR23
NCBI Reference AGV55623.1
Aliases /Synonyms SLC, sulfate transporter Ci-Slc26a alpha
Reference PX-P1150
Note For research use only
Molecular Constructor
Partial Yes
Product name PX-P1150-1MG
Uniprot ID T2DR23
Uniprot link http://www.uniprot.org/uniprot/T2DR23
Origin species Ciona intestinalis
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLLDGRAPIKHVIIDMSACSFIDNDAVKTFSSIHDDLSKLGIKLLLADCRNYVRKCFQAGNFGLSEKEDSP EGATPTPVFFISVTAALTYARTDDVTSDDPITANDVDD
Molecular weight 12,97 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 200mM if native conditions. PBS, imidazole 10mM, Urea 5M if denaturing conditions
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AGV55623.1
Spec:SwissProtID T2DR23
NCBI Reference AGV55623.1
Aliases /Synonyms SLC, sulfate transporter Ci-Slc26a alpha
Reference PX-P1150
Note For research use only
Molecular Constructor
Partial Yes

Ciona intestinalis SLC Recombinant Protein

There are no reviews yet.

Be the first to review “Ciona intestinalis SLC Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products