Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD279 Recombinant Protein |
|---|---|
| Uniprot ID | Q15116 |
| Uniprot link | http://www.uniprot.org/uniprot/Q15116 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLV |
| Molecular weight | 40kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Val170 |
| Aliases /Synonyms | PD1 |
| Reference | PX-P4117 |
| Note | For research use only. |
CD279 (programmed cell death protein 1; PD-1) is a type I transmembrane protein that belongs to the CD28 / CTLA-4 family of immune receptors, which mediates signals that regulate immune responses. Members of the CD28 / CTLA-4 family have been shown to promote T cell activation (CD28 and ICOS) or deactivate T cell activation (CTLA-4 and PD-1). CD279 is expressed on activated T cells, B cells, bone marrow cells, and some thymocytes. In vitro, CD279 binding can prevent TCR-mediated T cell proliferation and the production of IL-1, IL-4, IL-10, and IFN-γ. Furthermore, the binding of CD279 can also prevent BCR signaling. CD279-deficient mice have defective peripheral tolerance and spontaneously develop autoimmune diseases.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Nivolumab Biosimilar - Anti-PD1 mAb (cat. No.PX-TA1004) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Penpulimab Biosimilar- Anti-Pd-1 mAb (cat. No.PX-TA1638) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.