Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD279 Recombinant Protein |
---|---|
Uniprot ID | Q15116 |
Uniprot link | http://www.uniprot.org/uniprot/Q15116 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLV |
Molecular weight | 40kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
Storage condition | Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1~Val170 |
Aliases /Synonyms | PD1 |
Reference | PX-P4117 |
Note | For research use only. |
CD279 (programmed cell death protein 1; PD-1) is a type I transmembrane protein that belongs to the CD28 / CTLA-4 family of immune receptors, which mediates signals that regulate immune responses. Members of the CD28 / CTLA-4 family have been shown to promote T cell activation (CD28 and ICOS) or deactivate T cell activation (CTLA-4 and PD-1). CD279 is expressed on activated T cells, B cells, bone marrow cells, and some thymocytes. In vitro, CD279 binding can prevent TCR-mediated T cell proliferation and the production of IL-1, IL-4, IL-10, and IFN-γ. Furthermore, the binding of CD279 can also prevent BCR signaling. CD279-deficient mice have defective peripheral tolerance and spontaneously develop autoimmune diseases.
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Nivolumab Biosimilar - Anti-PD1 mAb (cat. No.PX-TA1004) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.