Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Canakinumab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Canakinumab ELISA Kit

Canakinumab ELISA Kit

Product name Canakinumab ELISA Kit
Uniprot ID P01584
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX131
Note For research use only.
Sample type Plasma, Serum
Target Canakinumab
Immunogen Canakinumab

Canakinumab ELISA Kit: A Comprehensive Guide Introduction

Canakinumab is a human monoclonal antibody that targets interleukin-1 beta (IL-1β), a pro-inflammatory cytokine involved in various inflammatory diseases. It is primarily used as a therapeutic agent for the treatment of rare auto-inflammatory disorders such as cryopyrin-associated periodic syndromes (CAPS) and systemic juvenile idiopathic arthritis (SJIA). The development of a Canakinumab ELISA kit has greatly facilitated the detection and quantification of this important therapeutic target.

Structure of Canakinumab

Canakinumab is a fully human IgG1 monoclonal antibody with a molecular weight of approximately 148 kDa. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of Canakinumab specifically binds to IL-1β, preventing its interaction with its receptor and inhibiting its pro-inflammatory effects.

ELISA Principle

ELISA (enzyme-linked immunosorbent assay) is a widely used technique for the detection and quantification of various molecules, including antibodies and antigens. The Canakinumab ELISA kit utilizes the principle of sandwich ELISA, where the target molecule is captured between two specific antibodies. In this case, the IL-1β present in the sample is captured by the Canakinumab-coated plate and detected by a secondary antibody conjugated with an enzyme. The resulting color change is then measured and is proportional to the amount of IL-1β present in the sample.

Application of Canakinumab ELISA Kit

The Canakinumab ELISA kit has a wide range of applications in both research and clinical settings. It is primarily used for the quantification of Canakinumab levels in patient samples, allowing for the monitoring of drug efficacy and dosing optimization. Additionally, it can also be used to measure IL-1β levels in various biological samples, providing valuable insights into the inflammatory status of a patient.

Monitoring Canakinumab Therapy

Canakinumab ELISA kit is an essential tool for monitoring the efficacy of Canakinumab therapy in patients with CAPS and SJIA. By measuring the levels of Canakinumab in the blood, clinicians can determine if the drug is reaching therapeutic levels and adjust the dosage accordingly. This helps in optimizing treatment and ensuring better patient outcomes.

Assessment of Inflammatory Disorders

IL-1β is a key mediator of inflammation, and its levels are often elevated in various inflammatory disorders. Canakinumab ELISA kit can be used to measure IL-1β levels in biological samples, providing valuable information about the inflammatory status of a patient. This can aid in the diagnosis and monitoring of diseases such as rheumatoid arthritis, gout, and atherosclerosis.

Research Applications

The Canakinumab ELISA kit is also widely used in research studies to investigate the role of IL-1β in various diseases and to evaluate the efficacy of new anti-inflammatory therapies. It enables researchers to accurately measure Canakinumab levels in different biological samples, providing valuable insights into the mechanism of action of this therapeutic antibody.

Conclusion

The Canakinumab ELISA kit is an essential tool for the detection and quantification of Canakinumab and IL-1β in various biological samples. It has revolutionized the monitoring of Canakinumab therapy and has enabled researchers to gain a better understanding of the role of IL-1β in inflammatory diseases. With its high sensitivity and specificity, the Canakinumab ELISA kit is a valuable asset in the field of immunology and inflammation research.

Canakinumab ELISA Kit

There are no reviews yet.

Be the first to review “Canakinumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products