Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Calpurbatug Biosimilar – Anti-DNA-binding protein HU-alpha mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €192.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade

Product name Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade
Uniprot ID P0ACF0 & P0ACF4 & P0A6X7 & P0A6Y1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-DNA-binding protein HU-alpha, HU-2, NS2, hupA, b4000, JW3964, DNA-binding protein HU-beta, HU-1, NS1, hupB, hopD, b0440, JW0430, Integration host factor subunit alpha, IHF-alpha, ihfA, hid, himA, b1712, JW1702, Integration host factor subunit beta, IHF-beta, ihfB, himD, hip, b0912, JW0895
Reference PX-TA2054
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade
Uniprot ID P0ACF0 & P0ACF4 & P0A6X7 & P0A6Y1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-DNA-binding protein HU-alpha, HU-2, NS2, hupA, b4000, JW3964, DNA-binding protein HU-beta, HU-1, NS1, hupB, hopD, b0440, JW0430, Integration host factor subunit alpha, IHF-alpha, ihfA, hid, himA, b1712, JW1702, Integration host factor subunit beta, IHF-beta, ihfB, himD, hip, b0912, JW0895
Reference PX-TA2054
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2054-50
Uniprot ID P0ACF0 & P0ACF4 & P0A6X7 & P0A6Y1
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-DNA-binding protein HU-alpha, HU-2, NS2, hupA, b4000, JW3964, DNA-binding protein HU-beta, HU-1, NS1, hupB, hopD, b0440, JW0430, Integration host factor subunit alpha, IHF-alpha, ihfA, hid, himA, b1712, JW1702, Integration host factor subunit beta, IHF-beta, ihfB, himD, hip, b0912, JW0895
Reference PX-TA2054
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Calpurbatug Biosimilar – Anti-DNA-binding protein HU-alpha mAb – Research Grade is a novel therapeutic antibody that has been developed as a biosimilar to the anti-DNA-binding protein HU-alpha monoclonal antibody (mAb). This biosimilar has been designed to mimic the structure and function of the original anti-DNA-binding protein HU-alpha mAb, while also providing improved efficacy and safety profiles. In this article, we will explore the structure, activity, and potential applications of Calpurbatug Biosimilar in the field of antibody-based therapeutics.

Structure of Calpurbatug Biosimilar

Calpurbatug Biosimilar is a monoclonal antibody that is produced through recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The heavy and light chains are connected by disulfide bonds to form a Y-shaped structure, with the antigen-binding regions located at the tips of the Y. The antigen-binding regions are highly specific and recognize the target protein, DNA-binding protein HU-alpha.

Activity of Calpurbatug Biosimilar

The primary activity of Calpurbatug Biosimilar is to bind to the DNA-binding protein HU-alpha with high affinity and specificity. This binding prevents the interaction of HU-alpha with DNA, thereby inhibiting its function. HU-alpha is a critical protein involved in DNA replication, transcription, and repair, and its dysregulation has been linked to various diseases, including cancer and autoimmune disorders. By blocking the activity of HU-alpha, Calpurbatug Biosimilar has the potential to modulate these disease processes and provide therapeutic benefits.

In addition to its primary activity, Calpurbatug Biosimilar also possesses several secondary activities that contribute to its therapeutic potential. These include antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), and antibody-dependent cellular phagocytosis (ADCP). These mechanisms of action involve the recruitment and activation of immune cells, leading to the destruction of cells expressing HU-alpha, such as cancer cells or cells involved in autoimmune responses.

Applications of Calpurbatug Biosimilar

Calpurbatug Biosimilar has a wide range of potential applications in the field of antibody-based therapeutics. Its primary target, the DNA-binding protein HU-alpha, is overexpressed in various cancers, including breast, lung, and prostate cancer. By inhibiting the activity of HU-alpha, Calpurbatug Biosimilar has the potential to slow down or stop the growth of cancer cells, making it a promising candidate for cancer therapy.

Moreover, HU-alpha has also been implicated in autoimmune disorders, such as systemic lupus erythematosus and rheumatoid arthritis. By blocking the activity of HU-alpha, Calpurbatug Biosimilar may help to alleviate the symptoms of these diseases and provide relief to patients.

In addition to cancer and autoimmune disorders, Calpurbatug Biosimilar may also have potential applications in the field of infectious diseases. HU-alpha has been shown to play a role in the replication of viruses, such as HIV and hepatitis B, and its inhibition by Calpurbatug Biosimilar may help to control viral infections.

Conclusion

In summary, Calpurbatug Biosimilar – Anti-DNA-binding protein HU-alpha mAb – Research Grade is a novel therapeutic antibody with a specific structure and activity aimed at targeting the DNA-binding protein HU-alpha. Its potential applications in cancer, autoimmune disorders, and infectious diseases make it a promising candidate for further research and development. With its improved efficacy and safety profiles, Calpurbatug Biosimilar may offer a more effective and safer treatment option for patients in the future.

SDS-PAGE for Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade

SDS-PAGE for Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade

Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Calpurbatug Biosimilar - Anti-DNA-binding protein HU-alpha mAb - Research Grade

There are no reviews yet.

Be the first to review “Calpurbatug Biosimilar – Anti-DNA-binding protein HU-alpha mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products