Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lumiliximab Biosimilar – Anti-FCER2 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €189.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Lumiliximab Biosimilar - Anti-FCER2 mAb - Research Grade

Product name Lumiliximab Biosimilar - Anti-FCER2 mAb - Research Grade
Uniprot ID P06734
Source CAS 357613-86-6
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lumiliximab,IDEC-152,P5E8,FCER2,anti-FCER2
Reference PX-TA1114
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Lumiliximab Biosimilar - Anti-FCER2 mAb - Research Grade
Uniprot ID P06734
Source CAS 357613-86-6
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lumiliximab,IDEC-152,P5E8,FCER2,anti-FCER2
Reference PX-TA1114
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1114-50
Uniprot ID P06734
Source CAS 357613-86-6
Species Chimeric
Expression system Mammalian cells
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Molecular weight 48kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lumiliximab,IDEC-152,P5E8,FCER2,anti-FCER2
Reference PX-TA1114
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Lumiliximab Biosimilar – Anti-FCER2 mAb

Lumiliximab Biosimilar, also known as Anti-FCER2 mAb, is a monoclonal antibody that has been developed as a biosimilar to the original drug, Lumiliximab. This biosimilar has been designed to target the FCER2 protein, which plays a crucial role in the immune response. In this article, we will discuss the structure, activity and potential applications of Lumiliximab Biosimilar in the field of medicine.

Structure of Lumiliximab Biosimilar

Lumiliximab Biosimilar is a monoclonal antibody that belongs to the IgG1 subclass. It is composed of two heavy chains and two light chains, which are linked together by disulfide bonds. The heavy chains consist of a variable region, responsible for antigen binding, and a constant region, which determines the antibody’s effector functions. The light chains also have a variable and a constant region. The variable regions of both the heavy and light chains are highly specific for the FCER2 protein, allowing Lumiliximab Biosimilar to selectively bind to it.

Activity of Lumiliximab Biosimilar

The primary function of Lumiliximab Biosimilar is to bind to the FCER2 protein, which is found on the surface of certain immune cells, such as B cells and mast cells. This binding prevents the FCER2 protein from interacting with its ligands, which are involved in activating these immune cells. As a result, the activation of these cells is inhibited, leading to a decrease in the immune response. This activity makes Lumiliximab Biosimilar a potential therapeutic agent for various immune-related disorders, such as allergies and autoimmune diseases.

Title: Potential Applications of Lumiliximab Biosimilar

1. Treatment of Allergies: Allergies are caused by an exaggerated immune response to harmless substances, such as pollen or dust. Lumiliximab Biosimilar can be used to treat allergies by inhibiting the activation of immune cells that are responsible for the allergic reaction. This can help alleviate symptoms, such as sneezing, itching, and swelling.

2. Management of Autoimmune Diseases: In autoimmune diseases, the immune system mistakenly attacks healthy cells and tissues. By targeting the FCER2 protein, Lumiliximab Biosimilar can prevent the activation of immune cells that are involved in this process. This makes it a potential treatment option for diseases like rheumatoid arthritis, lupus, and multiple sclerosis.

3.

Cancer Therapy: FCER2 has been found to be overexpressed in certain types of cancer cells, making it a potential therapeutic target. Lumiliximab Biosimilar can be used to specifically target these cancer cells, leading to their destruction and potentially improving the outcome of cancer treatment.

4. Research Tool: Lumiliximab Biosimilar can also be used as a research tool to study the role of FCER2 in various immune-related processes. Its specific binding to FCER2 allows for the isolation and detection of these cells, providing valuable insights into their function and potential therapeutic applications.

Conclusion:

Lumiliximab Biosimilar – Anti-FCER2 mAb is a promising therapeutic agent with a specific and targeted mechanism of action. Its structure, activity, and potential applications make it a valuable addition to the field of medicine. With ongoing research and development, this biosimilar has the potential to improve the treatment of various immune-related disorders and contribute to a better understanding of the immune system.

SDS-PAGE for Lumiliximab Biosimilar - Anti-CD23;FCER2 mAb - Research Grade

SDS-PAGE for Lumiliximab Biosimilar - Anti-CD23;FCER2 mAb - Research Grade

Lumiliximab Biosimilar - Anti-CD23;FCER2 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lumiliximab Biosimilar - Anti-FCER2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Lumiliximab Biosimilar – Anti-FCER2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products