Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brolucizumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Brolucizumab ELISA Kit

Brolucizumab ELISA Kit

Product name Brolucizumab ELISA Kit
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX188
Note For research use only.
Sample type Plasma, Serum
Target Brolucizumab
Immunogen Brolucizumab

Introduction

Brolucizumab is a novel antibody-based drug that has recently been approved by the US Food and Drug Administration (FDA) for the treatment of neovascular (wet) age-related macular degeneration (AMD). This condition is a leading cause of blindness in older adults, and brolucizumab offers a promising new treatment option. In order to better understand the mechanism of action and potential applications of brolucizumab, scientists have developed an ELISA kit specifically designed to measure its levels in biological samples. This article will provide a comprehensive description of the Brolucizumab ELISA Kit, including its structure, activity, and potential applications.

Structure

The Brolucizumab ELISA Kit is composed of several components, including a microplate coated with a specific antibody that binds to brolucizumab, a biotinylated detection antibody, streptavidin-HRP conjugate, and a tetramethylbenzidine (TMB) substrate. The microplate contains multiple wells, each of which can be used to analyze a different sample. The specific antibodies used in this kit have been carefully selected and validated to ensure high specificity and sensitivity in detecting brolucizumab.

Activity

The Brolucizumab ELISA Kit is designed to measure the levels of brolucizumab in various biological samples, including serum, plasma, and cell culture supernatants. The assay is based on the principle of the enzyme-linked immunosorbent assay (ELISA), which utilizes the specific binding of antibodies to their target molecules. In this case, the coated antibody on the microplate binds to brolucizumab, while the biotinylated detection antibody recognizes a different epitope on the drug. The streptavidin-HRP conjugate then binds to the biotinylated antibody, and the addition of the TMB substrate results in a color change that is proportional to the amount of brolucizumab present in the sample. The absorbance of the colored solution can be measured using a spectrophotometer, and the concentration of brolucizumab can be calculated based on a standard curve.

Applications

The Brolucizumab ELISA Kit has several potential applications in the field of ophthalmology and drug development. One of its main uses is in pharmacokinetic studies, where it can be used to measure the levels of brolucizumab in the blood or other biological fluids over time. This information is crucial for determining the optimal dosing regimen and monitoring the drug’s efficacy in patients. Additionally, the kit can be used to screen potential therapeutic candidates that target brolucizumab, as well as to assess the drug’s stability and purity during the manufacturing process.

Furthermore, the Brolucizumab ELISA Kit can also be used in clinical trials to evaluate the drug’s safety and efficacy in patients with neovascular AMD. By measuring the levels of brolucizumab in patients’ blood, researchers can determine the drug’s bioavailability and its ability to reach the target tissue. This information can also help in identifying potential adverse effects or drug interactions.

Conclusion

In summary, the Brolucizumab ELISA Kit is a valuable tool for researchers and clinicians studying brolucizumab and its potential applications in the treatment of neovascular AMD. Its specific structure, activity, and potential applications make it a reliable and accurate method for measuring the drug’s levels in various biological samples. As brolucizumab continues to be studied and utilized in clinical practice, the Brolucizumab ELISA Kit will play a crucial role in advancing our understanding of this promising new therapeutic target.

Brolucizumab ELISA Kit

There are no reviews yet.

Be the first to review “Brolucizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products