Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brivekimig Biosimilar – Anti-CD252;TNFA;ALB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Ig IG single chain of 5 VH (VH-VH-VH'-VH''-VH') monomer

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Brivekimig Biosimilar - Anti-CD252;TNFA;ALB mAb - Research Grade

Product name PX-TA2180-50
Uniprot ID P23510 & P01375 & P02768
Source Trispecific, Pentavalent, CAS: 2834733-45-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD252, OX40L, TXGP1, OX40 ligand, Glycoprotein Gp34, TAX transcriptionally-activated glycoprotein 1, TNFSF4, Tumor necrosis factor ligand superfamily member 4, TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1, ALB, Albumin
Reference PX-TA2180-100
Note For research use only. Not suitable for human use.
Isotype Ig IG single chain of 5 VH (VH-VH-VH'-VH''-VH') monomer
Clonality Monoclonal Antibody
Product name Brivekimig Biosimilar - Anti-CD252;TNFA;ALB mAb - Research Grade
Uniprot ID P23510 & P01375 & P02768
Source Trispecific, Pentavalent, CAS: 2834733-45-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD252, OX40L, TXGP1, OX40 ligand, Glycoprotein Gp34, TAX transcriptionally-activated glycoprotein 1, TNFSF4, Tumor necrosis factor ligand superfamily member 4, TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1, ALB, Albumin
Reference PX-TA2180-100
Note For research use only. Not suitable for human use.
Isotype Ig IG single chain of 5 VH (VH-VH-VH'-VH''-VH') monomer
Clonality Monoclonal Antibody
Product name Brivekimig Biosimilar - Anti-CD252;TNFA;ALB mAb - Research Grade
Uniprot ID P23510 & P01375 & P02768
Source Trispecific, Pentavalent, CAS: 2834733-45-6
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD252, OX40L, TXGP1, OX40 ligand, Glycoprotein Gp34, TAX transcriptionally-activated glycoprotein 1, TNFSF4, Tumor necrosis factor ligand superfamily member 4, TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1, ALB, Albumin
Reference PX-TA2180-100
Note For research use only. Not suitable for human use.
Isotype Ig IG single chain of 5 VH (VH-VH-VH'-VH''-VH') monomer
Clonality Monoclonal Antibody

Introduction

Brivekimig Biosimilar – Anti-CD252;TNFA;ALB mAb – Research Grade is a therapeutic antibody that has been designed to target and inhibit the activity of CD252, TNFA, and ALB. This biosimilar is a highly specific and potent treatment option for a variety of diseases and conditions, and has shown promising results in clinical trials.

Structure

Brivekimig Biosimilar is a monoclonal antibody (mAb) that is produced through recombinant DNA technology. It is a humanized antibody, meaning that it is derived from non-human sources but has been modified to be more similar to human antibodies. This modification reduces the likelihood of adverse reactions and improves the efficacy of the antibody.

The antibody has a complex structure, consisting of two heavy chains and two light chains, each with a specific amino acid sequence. The heavy chains are responsible for binding to the target molecules, while the light chains aid in the stability and function of the antibody.

The binding region of the antibody, also known as the variable region, is highly specific for CD252, TNFA, and ALB. This allows the antibody to selectively target and bind to these molecules, inhibiting their activity and preventing them from causing harm.

Activity

The primary activity of Brivekimig Biosimilar is to inhibit the activity of CD252, TNFA, and ALB. These molecules are known to play a role in various inflammatory and autoimmune diseases, as well as cancer. By binding to these molecules, the antibody blocks their function and reduces the inflammatory response, leading to improved disease outcomes.

In addition to its anti-inflammatory activity, Brivekimig Biosimilar also has immunomodulatory effects. It can regulate the activity of immune cells, such as T cells and B cells, and promote a more balanced immune response. This is particularly beneficial in autoimmune diseases where the immune system is overactive and attacking healthy tissues.

Furthermore, the antibody has been shown to have a direct cytotoxic effect on cancer cells. By binding to TNFA, which is often overexpressed in cancer cells, Brivekimig Biosimilar can induce cell death and inhibit tumor growth.

Application

Brivekimig Biosimilar has a wide range of applications in the treatment of various diseases and conditions. Its anti-inflammatory and immunomodulatory properties make it a promising option for the treatment of autoimmune diseases, such as rheumatoid arthritis, psoriasis, and Crohn’s disease.

The antibody also has potential in the treatment of inflammatory conditions, such as asthma and allergies, where CD252 and TNFA play a role in the inflammatory response. It has shown promising results in clinical trials for these indications.

In addition, Brivekimig Biosimilar has shown potential as a cancer treatment. Its ability to directly target and kill cancer cells, as well as its immunomodulatory effects, make it a promising option for various types of cancer, including solid tumors and hematological malignancies.

Conclusion

In summary, Brivekimig Biosimilar – Anti-CD252;TNFA;ALB mAb – Research Grade is a highly specific and potent therapeutic antibody with a complex structure and multiple activities. Its ability to target and inhibit the activity of CD252, TNFA, and ALB makes it a promising treatment option for a wide range of diseases and conditions, including autoimmune diseases, inflammatory conditions, and cancer. Further research and clinical trials are needed to fully explore the potential of this biosimilar in improving patient outcomes.

SDS-PAGE for Brivekimig Biosimilar - Research Grade

SDS-PAGE for Brivekimig Biosimilar - Research Grade

Brivekimig Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Brivekimig Biosimilar – Anti-CD252;TNFA;ALB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products