Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade

  • PX-TA2210-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
Ig Fab VH-G1CH1h_L-kappa

Original price was: €195.00.Current price is: €140.00.

50ug 28% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Pegrizeprument Biosimilar - Anti-CD28 mAb - Research Grade

Product name PX-TA2210-50
Uniprot ID P10747
Source CAS: 2829316-24-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28
Reference PX-TA2210-100
Note For research use only. Not suitable for human use.
Isotype Ig Fab VH-G1CH1h_L-kappa
Clonality Monoclonal Antibody
Product name Pegrizeprument Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source CAS: 2829316-24-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28
Reference PX-TA2210-100
Note For research use only. Not suitable for human use.
Isotype Ig Fab VH-G1CH1h_L-kappa
Clonality Monoclonal Antibody
Product name Pegrizeprument Biosimilar - Anti-CD28 mAb - Research Grade
Uniprot ID P10747
Source CAS: 2829316-24-5
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-CD28, TP44, T-cell-specific surface glycoprotein CD28
Reference PX-TA2210-100
Note For research use only. Not suitable for human use.
Isotype Ig Fab VH-G1CH1h_L-kappa
Clonality Monoclonal Antibody

Introduction

Pegrizeprument Biosimilar, also known as Anti-CD28 mAb, is a therapeutic antibody that has shown promising results in the treatment of various diseases. This biosimilar is a research grade version of the original Pegrizeprument, which is a monoclonal antibody targeting the CD28 protein. In this article, we will discuss the structure, activity, and applications of Pegrizeprument Biosimilar in detail.

Structure of Pegrizeprument Biosimilar

Pegrizeprument Biosimilar is a monoclonal antibody, which means it is a clone of a single type of antibody produced by a single cell line. It is a humanized antibody, meaning it is derived from human antibodies but has been modified to reduce the risk of immune reactions. The antibody consists of two identical heavy chains and two identical light chains, linked together by disulfide bonds. It has a molecular weight of approximately 150 kDa.

The variable region of Pegrizeprument Biosimilar is responsible for binding to the CD28 protein, while the constant region is responsible for activating the immune system. This antibody has a high affinity for CD28, which is a co-stimulatory receptor found on T cells. By binding to CD28, Pegrizeprument Biosimilar can modulate T cell activity and enhance immune responses.

Activity of Pegrizeprument Biosimilar

Pegrizeprument Biosimilar exerts its activity by targeting the CD28 protein, which plays a crucial role in T cell activation and proliferation. When T cells encounter an antigen, they require two signals to become fully activated. The first signal is provided by the T cell receptor (TCR) binding to the antigen, and the second signal is provided by the interaction between CD28 and its ligands on antigen-presenting cells (APCs).

Pegrizeprument Biosimilar blocks the interaction between CD28 and its ligands, thereby inhibiting the second signal and preventing T cell activation. This can be beneficial in conditions where excessive T cell activation and proliferation contribute to disease progression, such as autoimmune disorders and transplant rejection.

Moreover, Pegrizeprument Biosimilar has been shown to induce regulatory T cells (Tregs), which play a critical role in maintaining immune homeostasis. Tregs can suppress the activity of other immune cells, thereby preventing excessive inflammation and tissue damage. By promoting the development of Tregs, Pegrizeprument Biosimilar can help in the treatment of autoimmune diseases.

Applications of Pegrizeprument Biosimilar

Pegrizeprument Biosimilar has shown promising results in the treatment of various diseases, including autoimmune disorders, transplant rejection, and cancer. In autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, Pegrizeprument Biosimilar can inhibit T cell activation and reduce inflammation, thereby alleviating symptoms and slowing disease progression.

In transplant rejection, Pegrizeprument Biosimilar can prevent the activation of T cells that can damage the transplanted organ. This can improve the success rate of organ transplantation and reduce the need for immunosuppressive drugs, which can have severe side effects.

Pegrizeprument Biosimilar has also shown potential in cancer treatment. By inhibiting T cell activation, it can prevent the immune system from attacking cancer cells, which can evade immune surveillance by expressing CD28 ligands. Moreover, Pegrizeprument Biosimilar can enhance the activity of Tregs, which can suppress the growth of tumors. Clinical trials are currently underway to evaluate the efficacy of Pegrizeprument Biosimilar in various types of cancer.

Conclusion

In summary, Pegrizeprument Biosimilar is a research grade therapeutic antibody targeting the CD28 protein. It has a unique structure and exerts its activity by inhibiting T cell activation and promoting the development of Tregs. This biosimilar has shown promising results in the treatment of autoimmune diseases, transplant rejection, and cancer. Further research and clinical trials are needed to fully understand the potential of Pegrizeprument Biosimilar in

Pegrizeprument Biosimilar - Research Grade binds to Recombinant Mouse CD28 Protein, N-His-SUMO in WB Assay

Pegrizeprument Biosimilar - Research Grade binds to Recombinant Mouse CD28 Protein, N-His-SUMO in WB Assay

Recombinant Mouse CD28 Protein, N-His-SUMO(cat. No.ARO-P11085) can bind Pegrizeprument Biosimilar - Research Grade in Western Blot Assay as detected on gel analysis.

SDS-PAGE for Pegrizeprument Biosimilar - Research Grade

SDS-PAGE for Pegrizeprument Biosimilar - Research Grade

Pegrizeprument Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Pegrizeprument Biosimilar – Anti-CD28 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products